SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025425 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025425
Domain Number 1 Region: 436-568
Classification Level Classification E-value
Superfamily TIMP-like 2.04e-25
Family Netrin-like domain (NTR/C345C module) 0.02
Further Details:      
 
Domain Number 2 Region: 211-307
Classification Level Classification E-value
Superfamily Immunoglobulin 7.74e-20
Family I set domains 0.017
Further Details:      
 
Domain Number 3 Region: 390-443
Classification Level Classification E-value
Superfamily BPTI-like 1.56e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0047
Further Details:      
 
Domain Number 4 Region: 325-384
Classification Level Classification E-value
Superfamily BPTI-like 0.000000000000184
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.014
Further Details:      
 
Domain Number 5 Region: 128-179
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000000152
Family Ovomucoid domain III-like 0.032
Further Details:      
 
Domain Number 6 Region: 37-83
Classification Level Classification E-value
Superfamily Elafin-like 0.00000144
Family Elafin-like 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025425   Gene: ENSGACG00000019237   Transcript: ENSGACT00000025475
Sequence length 580
Comment pep:novel group:BROADS1:groupIX:16091937:16094434:-1 gene:ENSGACG00000019237 transcript:ENSGACT00000025475 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
APDVNKLVKGWMRAYLLLLLVCKFPELSFCSSDAGSTVEHEGFCPNKLNSNLWVDAQSTC
ERECNVDEDCADFEKCCTNVCGLNSCVAARFSDGTPAQPDGQAGGDGNGATNSTATCEDF
ICSQQGATCDIWEGQPICKCQDRCEKEPNFTCASDGLTYFNRCYMDAEACIGGVTLTVVP
CRFYLAGPHTSPLPRDTTANPTPTSSQEDPMPPALFSNPHHQSVYVGGTVSFHCDVVGAP
RPDVTWEKRNERREQLVMRPDQMYGNVVITNIGQLVIYNAQVWDTGIYTCIARNSAGVLR
ADYPLSVIRRAGDDFSEDPEMPMGRPFSPADCHAEVDLRVCSGERHVDWYYDGKQGSCVA
FSNGGCDDSRNRFETYEECKASCQREGMGICFLPAVQGPCKSWEPRWAWNSILKQCQAYA
YGGCHGNANSFSTKKECEANCPQPKKKPCKPCRAKGKMVPSLCRSDFAIVGRLTELVEDL
DSGLARFSLEEVLRDEKMGLTLFNTKHLEVTIAKIDWSCPCPNITMEENPLLVMGVVQDG
MAIIQSDSYVRAITDRRLKKLREVLNKMTCEVLRLYNGLQ
Download sequence
Identical sequences G3Q6B6
ENSGACP00000025425 69293.ENSGACP00000025425 ENSGACP00000025425

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]