SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025526 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025526
Domain Number 1 Region: 615-927
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.78e-91
Family Protein kinases, catalytic subunit 0.0000000439
Further Details:      
 
Domain Number 2 Region: 210-286
Classification Level Classification E-value
Superfamily HR1 repeat 2.49e-23
Family HR1 repeat 0.0026
Further Details:      
 
Domain Number 3 Region: 18-97
Classification Level Classification E-value
Superfamily HR1 repeat 1.18e-20
Family HR1 repeat 0.00015
Further Details:      
 
Domain Number 4 Region: 121-197
Classification Level Classification E-value
Superfamily HR1 repeat 1.44e-20
Family HR1 repeat 0.00015
Further Details:      
 
Domain Number 5 Region: 390-480
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.0000000131
Family PLC-like (P variant) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025526   Gene: ENSGACG00000019310   Transcript: ENSGACT00000025576
Sequence length 945
Comment pep:novel group:BROADS1:groupIX:16414532:16426860:-1 gene:ENSGACG00000019310 transcript:ENSGACT00000025576 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLFLVVQSDPGGLSVLEQLGLDQNSDFSDTGVQQLLDEHRERIRREIRRELKIKEGAENL
RRATTDKRNAQQVESQLRSSNRKLDDLHAQLQELDAHIVHLVPSIGTDECPQSPGAESRT
SAHKERIAALERQLNIELKVKQGVENMIPIYGLQSPFNQDKKMLQTAQQMQQDSKTKIDI
IRMQIRKAVQATEHNEDTQAPNTAGNQDLCGMELRIEELRHHYRVEHAVAEGAKNVLRLL
GAGKVQDKKALSEAQSRLSEASQRLDLLRDSLDQRLAELPEDHPKATVIKEELVLASSPA
FSSRHGAPYLHNQYNTLNKPSPLTGTLQVQVLGCVGLLEVVPGRTKGVAVMLPCYSPGDT
RSFMRGSKGLYGRSGSVSGKTPSKAEELSLAEVSAVLKLDNGVVGQTAWKTVGEQAWDQT
FTVELERSREMEIAVYWKDYRSLCALKYLKLEEFLDNQKHRVQLELEPQGLLMAEVIFFN
PVIERVPRLQRQKKVFSKQQGKAFLRARQMNVDIGTWVRLLRNAIPTANNSGTYSPNTQG
LMLSAGEVSVEKLNLDSDSPMRVFLSSRVPPQDRLTVIEPFSPPDLTPECPVRTQSIGRL
RVRLSSKQRKGPLSLQDFRLIAVLGRGHFGKVLLSEYKKTGTMYAIKALKKGDIVARDEV
ESLMCEKRIFEVVNMSHHPFLVNLFACFQTPQHVCFVMEYTAGGDLMMHIHTDVFTEPRA
VFYAACVVLGLQFLHDHKIVYRDLKLDNLLLDTDGYVKIADFGLCKEGMGFGDRTSTFCG
TPEFLAPEVLTDTSYTRAVDWWGLGVLIYEMLVGESPFPGDDEEEVFDSIVNDEVRYPRF
LSTEAIGIMRRLLRRNPERRLGSGEKDAEEVKKQPFFRHVDWEALLQKKVPPPFIPSIVG
KEDVSNFDEEFTAEAPALTPPREPRVLSRKDQESFCDFDYVSDLC
Download sequence
Identical sequences G3Q6L6
ENSGACP00000025526 ENSGACP00000025526 69293.ENSGACP00000025526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]