SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025546 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025546
Domain Number 1 Region: 836-944
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.4e-23
Family Spermadhesin, CUB domain 0.0028
Further Details:      
 
Domain Number 2 Region: 313-440
Classification Level Classification E-value
Superfamily Growth factor receptor domain 8.79e-18
Family Growth factor receptor domain 0.019
Further Details:      
 
Domain Number 3 Region: 34-165
Classification Level Classification E-value
Superfamily Growth factor receptor domain 3.77e-17
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 4 Region: 275-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000678
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 206-249
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000882
Family EGF-type module 0.019
Further Details:      
 
Domain Number 6 Region: 653-756
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000209
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 7 Region: 714-832
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000283
Family Growth factor receptor domain 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025546
Domain Number - Region: 164-203
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000335
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025546   Gene: ENSGACG00000019325   Transcript: ENSGACT00000025596
Sequence length 1022
Comment pep:novel group:BROADS1:groupIV:24111028:24189980:-1 gene:ENSGACG00000019325 transcript:ENSGACT00000025596 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSACFSRDVCLFILLINTCRVMGDVGLAVRADPDECAEGSDDCHIDALCQNTPKSYNCI
CKPGYKGDGKQCEDMDECENDYNGGCVHECINIPGNYRCTCYDGFMLAHDGHNCQDVDEC
ADNNGGCQQVCVNTMGSYECQCTDGFFLSDNQHTCIHRSDDGMNCMNKAHGCAHICREAP
GKGGVSCECRPGFELAKNQKDCTLTCNYGNGGCQHTCDDTDTGPVCGCHQKYALHSDSKT
CIEKDEAAIESSEFNATSVADVDKRVKRRLLMETCAVNNGGCDRTCKDTATGVRCSCPVG
FTLQPDGKTCKDIDECQENNGGCDHFCRNTVGSFECSCQKGHKLLTDERTCQDIDECSFE
RTCDHICVNYPGSFECLCHKGHILYGLTHCGDIDECSISNGSCEYGCINTQGGYECVCPP
GQKLHWNKKDCIEAVKCLPNGKPALRAQLTCTKSVGAEVCSLSCPSNALFLADSENSYTL
SCGVPVQLGKAPQKRNATTALPTCADTLAPPIKQKARFKIKDAKCHLRPRNKEKHRESSR
QSLQGGQFPCTDDCHVTFVNLKCDSSKKRRRGRKSPSKEVSHITAEFEMEMKEEEASDLC
NVDCVRERMKQKLQSAMRTLRKSINKQQFYIQFSGTEYEVAQKPSRVLEGAEACSGQVLR
DGKCVSCSLGTFYSGEQQQCVQCPTGTYQDTGGQLSCEPCPSTEGQGIAGARNVSQCGGQ
CPAGHFSADGFHPCQPCQLGSYQTEPGRVLCFLCGGGLMTKYEGSVSFRDCEAKVHCAPG
HYYNSTTHRCIRCPGGTYQSEFGQNYCITCPGNTTTDFDGATNVSHCKNQLCGGELGEYT
GYIESPNYPGDYPSNVDCVWTINPPHKRRILIVVPEIFLPIEDECGDVLVMRKSALPTSI
TTYETCQTYERPIAFTSRSRKLWIQFKSNEGNSGKGFQVPYVTYDEDYQQLIEDIVRDGR
LYASENHQEILKDKKLIKALFDVLAHPQNYFRYTAQESKEMFPRSFIKLLRSKVTRFLRP
YK
Download sequence
Identical sequences G3Q6N6
ENSGACP00000025546 ENSGACP00000025546 69293.ENSGACP00000025546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]