SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025576 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025576
Domain Number 1 Region: 31-106
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000973
Family Growth factor receptor domain 0.0039
Further Details:      
 
Domain Number 2 Region: 100-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000753
Family Fibronectin type I module 0.028
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025576
Domain Number - Region: 242-285
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000602
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025576   Gene: ENSGACG00000019351   Transcript: ENSGACT00000025626
Sequence length 396
Comment pep:novel group:BROADS1:groupIX:16550919:16555661:-1 gene:ENSGACG00000019351 transcript:ENSGACT00000025626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLKIIMALLIYLTVLTTAFIAQVTASCPAVCDCPAEPLLCPPGVSAVPDGCGCCKVCAA
QLNQDCSHVRPCDHHKGLECNYGNDVTVALGICRAKSEGRTCEYNGRIHQNGESFRAGCK
HQCTCIDGAVGCAPLCTNKLPPASPSCPYPRLVRIPRQCCFSVDCHKGTWLLPPKHQAPP
PPQHFARRQHTPENESANEFAEVKSSGWESEHGYKHLPAIGLLQKILYCRTKLWSHLKEK
KCPLQITDWSQCSSSCGMAVSSRVTNKNPECKLERETRICTVRPCGGPTAPAKPQRGKKC
SPTQKAAEPIRLSYGGCASVRLYRPNYCGVCTDGRCCSPRRTRTAPVTFVCPDGERFRRS
AMFIQSCKCSDDCGHLNEVALPPQQWLYGDTHQFTD
Download sequence
Identical sequences G3Q6R6
69293.ENSGACP00000025576 ENSGACP00000025576 ENSGACP00000025576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]