SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025909 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025909
Domain Number 1 Region: 415-546
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000157
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 607-649
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000001
Family EGF-type module 0.0056
Further Details:      
 
Domain Number 3 Region: 762-805
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000803
Family EGF-type module 0.0071
Further Details:      
 
Domain Number 4 Region: 632-766
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000204
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 5 Region: 797-837
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000237
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 6 Region: 352-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000318
Family EGF-type module 0.0095
Further Details:      
 
Domain Number 7 Region: 274-319
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000815
Family EGF-type module 0.013
Further Details:      
 
Domain Number 8 Region: 317-346
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000181
Family EGF-type module 0.016
Further Details:      
 
Domain Number 9 Region: 831-875
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000146
Family VWC domain 0.047
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025909
Domain Number - Region: 572-607
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00377
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 396-424
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00633
Family EGF-type module 0.021
Further Details:      
 
Domain Number - Region: 243-280
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0231
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025909   Gene: ENSGACG00000019600   Transcript: ENSGACT00000025960
Sequence length 1204
Comment pep:novel group:BROADS1:groupIX:18456917:18473153:-1 gene:ENSGACG00000019600 transcript:ENSGACT00000025960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQVSSATGHFELQILSMQNANGRLQSGACCDAPRDATDRRCAADQCDTYFRVCLKEYQLK
VSSAGPCSFGTASTPVLGGNTFSLRDAKGDEASMVLPFSFAWPRSYTLIVEALDFNNDSS
SGSLGGAALIEKAVHSGMINPSRRWQSLKHNGPVAQFHFQVRLGCDEHYYGFGCNKFCRP
RDDFFGHYECDHNGNKTCLEGWAGPDCNTAICRQGCNTAHGNCIAPGECRCLYGWKGEYC
DQCIPHPGCVHGSCVEPWQCLCDTNYGGQLCDKDLNTCATLQPCVNGGTCSNTGPDKYHC
SCPDGFSGVSCQKADHACLSNPCLSGGSCVETSQGLECLCAPGWTEPSSPNNVDECLVNP
CSHGGTCEDLVNGFRCTCPPQWTGKTCLIDANECDEDPCANANSCRNLIGGYFCECVPGW
TGRNCDANINDCRGQCRNGATCEDLVSGYECACAPGFAGEHCEKDVDECASGPCLNGGRC
HDDVDGFRCLCPAGFSGSRCQLDIDYCLDRPCQNGGRCFNLAAEYVCKCPDDFEGKNCSR
MKDHCRTTPCKVIDSCTVAVASNSTPDGVRLILSNVCGPHGRCRSHAGGQFSCECEEGFS
GTYCHENINDCESAPCLHGGTCVDEVSRYRCVCADGWDGPTCQNNIDDCSSAPCRNRGVC
RDLVNDFYCECGDGWKGKTCRSTEFQCDEATCNSGGTCFDEGDAFKCLCAAGWEGATCSI
AAARSSSCVPSPCENGGTCVVDGDSFSCLCKEGWEGATCSHNVNDCSPHPCYNSGTCVDG
DNWYRCECAAGFAGPDCRINVNECQSSPCSSGATCVDEINAFRCICPPGRTGPRCQEASG
RPCVVGGLVAPDGSRWGEDCNTCRCHSGRIVCTKVTGEKVDPFPTLVLSGAFLLTRRLIV
SQVECVSPAHRTPPPARCHPESSCANVTFTFSQDIGAMGVTAEQVCGELRSLYVVRNLSS
VSSISVTCEASLSTNKEIHAVIVSHSTDDRRRGPTFVKEITDGIMDLVSKRSANGTAIGA
IAEVRIQRRPSRDPDADRLVPLLVSAVVAVWALAIALTLLWLVRRRRKRSSTAGVAAPVA
EENNALHNSVSTAREQLYHIKNPIVKNTANQHQQQQQHHHLCQDKNAAHAQIWKRDAGSQ
SEEDEMDKRLQKARFPRATPTYSLVDWEEPHHHHPHHHAERNPPHRTSKRDNRQQSANRM
EYIV
Download sequence
Identical sequences G3Q7P9
ENSGACP00000025909 69293.ENSGACP00000025909 ENSGACP00000025909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]