SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025952 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025952
Domain Number 1 Region: 661-727
Classification Level Classification E-value
Superfamily Immunoglobulin 1.44e-17
Family I set domains 0.0052
Further Details:      
 
Domain Number 2 Region: 386-456
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000088
Family I set domains 0.035
Further Details:      
 
Domain Number 3 Region: 30-84
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000116
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 4 Region: 236-294
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000432
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 5 Region: 175-234
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000068
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 6 Region: 928-986
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000719
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 7 Region: 1048-1104
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000235
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 8 Region: 116-172
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000314
Family TSP-1 type 1 repeat 0.0054
Further Details:      
 
Domain Number 9 Region: 294-355
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000112
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000025952
Domain Number - Region: 981-1045
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00497
Family TSP-1 type 1 repeat 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025952   Gene: ENSGACG00000019629   Transcript: ENSGACT00000026003
Sequence length 1141
Comment pep:novel group:BROADS1:groupVII:6808550:6819446:-1 gene:ENSGACG00000019629 transcript:ENSGACT00000026003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGNHSNHIQKCNRLSVLSNLLPLFSSFIPGPWQACSRTCGAGTQRRAVRCQVLLSFTQSV
ADLPDDECEGAKPAASQSCYRTPCSGVLGQGKESKEEEEGEEEGKGETPEREELHDWEYE
GFTECSESCGGGVQEAVVICLNKQTREAAEQSLCVSSLRPPQLLQDCKTQPCPPRWDMGE
WSLCSATCGVGLLTRSVACTHRPSRDSNNTEALRDQDCPNPKPSPVQACNRFDCPPMWDT
RDWGQCSQSCGGGFQRRRVLCKQRLADGSILELPDTFCPSKSPANQQPCAKPECPPQWVT
TGWSQCSVTCGNGIQRLQAACRKQGADGGHWTVDSEDCSLMARPTKIRLCSLRLCEHSVK
PHPTILAQRKLYIQWRKGKKLQLVVGGYAYLLPWTTVVLRCPTRHFRKGHIQWLKEGKPL
FGLPRFSVTSPGHVKMQQLRSSDAGVYTCVAGQALEHFVLHIIGSKQKLSVPESWPLAGV
RQKDGQSDSQSAGVRFQELPISLNRYDSVVEHLLKLKGSLQSEKDTADKIHSSEKNKSTL
EDEDGASAEQLLLIADTERLDEIMPSLSAGLAGLSGEQLIAQFLSEWTVTRGETNESTLH
PPESAESSTQGPLLYKPNAKAHTSRPRVPLMIQRPKKVGGVPSADMIVHVGVPVLLQKPV
TLELRCEALGNPEPSLKWTKNGRELHYNSRVSLLSTGSLRIQSPIKVDEGLYTCTARNRL
GSTSLSSCCGSCQSLKSIEQSAVNNSLKTLTLYMFKRSRQLFLTIWSSTSWISATSERKL
PPIAVSPSCLHGPKSSSQLQIILNLLITGSVNMFNMLIFCNIKDHKNVVVFLFQGGRNCV
PGNGTGPNGITAASQSSRAVDKPAPSGILVLLHAVKLETFCKGFTEMFRYNEVQCYFCMQ
PMLQHFNTQISNTSLLTTVPFLSLVLIRWQMDPWSPCSANCGTGSQTRRVRCMKGPEGRS
LEVESKHCLSTGRRPSDNRQCNLLPCARWATTHWGACHGQCVGPGLAKQQRHVYCQDTNA
TKVPCRMCSGLQRPSSLRNCSTEACTLHWHVGPWTQCTATCGRHGFRSRQVTCAHRRTGK
AAREHHCMWRPRPPSWQRCNILSCGRGECRDSTRYCEKVRQLELCPLPQFKSRCCHSCRN
T
Download sequence
Identical sequences G3Q7U0
ENSGACP00000025952 ENSGACP00000025952 69293.ENSGACP00000025952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]