SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025953 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025953
Domain Number 1 Region: 35-170
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.73e-36
Family Galectin (animal S-lectin) 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025953   Gene: ENSGACG00000019637   Transcript: ENSGACT00000026004
Sequence length 171
Comment pep:novel group:BROADS1:groupIX:18648184:18649738:1 gene:ENSGACG00000019637 transcript:ENSGACT00000026004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPRSLVVSFSLALAVVLSSYSSLPLNRSMYFHANAVPFRGHIPGGMRPGKKVVVVGVVDS
CPDRFHVALTCGIGSAEPPPDVALELCVRFRDRQVLRRACVAGCWGDADRAAPFFPFIAG
QPFKIEIHCEQSRFRVFVDGQKLFDFHHRLTSLGDIDTLWIKGGVSVTKLA
Download sequence
Identical sequences G3Q7U1
69293.ENSGACP00000025953 ENSGACP00000025953 ENSGACP00000025953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]