SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026050 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026050
Domain Number 1 Region: 296-484
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.19e-62
Family SPRY domain 0.0000061
Further Details:      
 
Domain Number 2 Region: 9-79
Classification Level Classification E-value
Superfamily RING/U-box 2.95e-21
Family RING finger domain, C3HC4 0.0054
Further Details:      
 
Domain Number 3 Region: 88-148
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 1.68e-16
Family B-box zinc-binding domain 0.00088
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026050
Domain Number - Region: 216-254
Classification Level Classification E-value
Superfamily Ribbon-helix-helix 0.0207
Family Arc/Mnt-like phage repressors 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026050   Gene: ENSGACG00000019715   Transcript: ENSGACT00000026101
Sequence length 489
Comment pep:novel group:BROADS1:groupIX:18921590:18923281:-1 gene:ENSGACG00000019715 transcript:ENSGACT00000026101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASANYGPSEDQFLCSICLDVFTDPVTTPCGHNFCINCINEHWNTSDQNLCPMCKKDFTT
RPDLRVNTFISEMVVQFRQSAQQKASSSSSEQQMCTKHDKPLELFCKSDQTCVCALCTVL
DHKMHDVVPLKEEYEEKKVELKKTEAEIQQMIQKRRLKIQEIKHSVDLSEEDAGREKAEG
VQVFTDLMESVERGLKELLNTIEEKQETTKKQAEAFIRELEEEISELMKRSAEVEQLSLS
EDHLHLLQSSNIHQPPPTKDWTEVSVCPSYEGTVVRAVSQLEETLSKKMKKWFAELKRVQ
MFAVDLTLDPETAHPRLILSDDGKQVKHLDVKKKLPNNPERFSNRLCVLTKQSFSSGRFY
FEVQVEGKTEWDLGVIRESVNRKGFISLSSLLSPQDGYWIICLTYGNEYKALDDPPVVLS
VKSGPQKVGVFVDYEEGVVSFYDVEAAALIYSFTGCSFTEKLFPFFCPGYSIFGRNSAPL
IISPVGGIN
Download sequence
Identical sequences G3Q836
ENSGACP00000026050 69293.ENSGACP00000026050 ENSGACP00000026050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]