SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026153 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026153
Domain Number 1 Region: 467-697
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.85e-47
Family Eukaryotic proteases 0.0000331
Further Details:      
 
Domain Number 2 Region: 198-284
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-32
Family Kringle modules 0.00015
Further Details:      
 
Domain Number 3 Region: 100-199
Classification Level Classification E-value
Superfamily Kringle-like 4.35e-30
Family Kringle modules 0.0002
Further Details:      
 
Domain Number 4 Region: 289-372
Classification Level Classification E-value
Superfamily Kringle-like 2.3e-29
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 5 Region: 375-461
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-26
Family Kringle modules 0.00052
Further Details:      
 
Domain Number 6 Region: 27-113
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 3.06e-19
Family Hairpin loop containing domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026153   Gene: ENSGACG00000019791   Transcript: ENSGACT00000026204
Sequence length 705
Comment pep:novel group:BROADS1:groupIV:30094179:30109243:1 gene:ENSGACG00000019791 transcript:ENSGACT00000026204 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTRVWIYQAVVCVVVTVLNTGFCRPPMLQKYEKSESRMLVCADCPQPLVRKVRSQENCA
HKCKNVKKNFTCRAFNFQRHTRKCYLLPFDRFTRGVQKQADVNFTLYEKKDYIRECIVGT
KDDYRGRRSWTKSNITCQAWSDNNINEHTFYPDRYTAHDLRENFCRNPNNDPGGPWCYTT
DPNVRAEECGVPQCSEEVCMTCNGESYRGKLDHTESGKECQRWDSPRPNKHHFQPKKYRH
KDLRDNYCRNPDNRLRPWCYTMDPKTPWEYCNITLCDSDSCEDIDVNVTTSCVQEKGTDY
RGTMNVTPEGVRCQRWDSQSPHNHSFLPQNFRCKDLRENYCRNPDGADYPWCFTTDPSQR
TANCTHIPRCDAEATEKNECYEDNGEAYRGTLSITRSGIPCADWSHHINSGDSHSTESHV
GLEKNHCRNPDRDKHGPWCYTNPNNRLAWDYCNLKHCEGPLTGPKISCFVHINTRIVGGH
QVRGTDGSWVVSIQREKVHLCGGSLIREDWILTDQQCFTSCVPDLRDYTVQVGLRHLNES
SGHPRLRISRLICGPEGSNLVMLKLVDPAPVSEGASTIHLPVKECHIPEGTNCTMYGWGE
TKNTGHDEALNALTMPMVNNDMCSQIKGDAGERRICAGGKRGEGVCDKDNGGPLVCQEHE
RKVVIGVSIQRTKCASSQPALFVNVAFYSEWIYKVFRLYPSLERN
Download sequence
Identical sequences G3Q8D9
69293.ENSGACP00000026153 ENSGACP00000026153 ENSGACP00000026153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]