SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026181 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026181
Domain Number 1 Region: 8-239
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.02e-36
Family Eukaryotic proteases 0.00077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026181   Gene: ENSGACG00000019813   Transcript: ENSGACT00000026232
Sequence length 240
Comment pep:novel group:BROADS1:groupIX:19617732:19619991:1 gene:ENSGACG00000019813 transcript:ENSGACT00000026232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGLVLLLWAGVTVASQVDLHKRIYGGRDCLHDERPHHVDLTSTSDPDYFCGGTLISNQW
VLTAAHCHEPGETIIAHLGNPRRQYTITDKKKLTKWFFIKHDIMLLKLPDTVPDPFAALP
TDCSGHPPNEFFVCLVTFYVYFHLERLAADEQKPLQCVELEVVPCSCPISSSYEYPNIFC
YKGAGKGTNPGDSGSGVMYGGTLYGVHVAGIIENCNANSAAVKVCEKIYLDWINKIINDN
Download sequence
Identical sequences G3Q8G7
ENSGACP00000026181 69293.ENSGACP00000026181 ENSGACP00000026181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]