SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026451 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026451
Domain Number 1 Region: 24-139
Classification Level Classification E-value
Superfamily C-type lectin-like 8.22e-24
Family C-type lectin domain 0.0013
Further Details:      
 
Domain Number 2 Region: 148-258
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-22
Family C-type lectin domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026451   Gene: ENSGACG00000020023   Transcript: ENSGACT00000026502
Sequence length 272
Comment pep:novel group:BROADS1:groupVII:9405783:9407441:1 gene:ENSGACG00000020023 transcript:ENSGACT00000026502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMERIWMVVFFLTDWNTSLCLPGQYHFVANSTTWDEARRHCRETFKDLATIQSAEDVNQL
VNTASSFGYNNEVWIGLFSVIDWRWSDGSNGSGWEYRNWENLLDNEPDFYSFRQFCVNVG
DKGRWWDDVCSIHYPFICYRGDQLDPEYVIVNLEMSWSDAQTYCREKFIDLATVRNETEN
NKIQRLVPVGNWAWIGLFRDPNIYWSSGSNYLNTSFSFWGTSTTDMGSMTRMCGLADLQL
SGGWRLTSCASRLPFVCHDIPELNDPAVNANI
Download sequence
Identical sequences G3Q987
69293.ENSGACP00000026451 ENSGACP00000026451 ENSGACP00000026451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]