SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026517 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026517
Domain Number 1 Region: 335-400
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000949
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 2 Region: 766-816
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000103
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 3 Region: 955-1002
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000106
Family Laminin-type module 0.0027
Further Details:      
 
Domain Number 4 Region: 270-337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000272
Family Laminin-type module 0.054
Further Details:      
 
Domain Number 5 Region: 509-550
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000586
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 6 Region: 1064-1106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000446
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 7 Region: 457-501
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000243
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 8 Region: 398-448
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000614
Family Laminin-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026517
Domain Number - Region: 930-957
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000159
Family Laminin-type module 0.02
Further Details:      
 
Domain Number - Region: 1007-1061
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000243
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number - Region: 1112-1159
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000246
Family Laminin-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026517   Gene: ENSGACG00000020070   Transcript: ENSGACT00000026568
Sequence length 1766
Comment pep:novel group:BROADS1:groupIV:32332924:32346066:-1 gene:ENSGACG00000020070 transcript:ENSGACT00000026568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AGSSPLLPAALCCSVRAQQQLPEFPDVCTEGSCYPATGDLLIGRAHKLSVSSTCGAERPE
RFCIVGHLEKDALTILCQRGQRTENTPFDSSVEPVTFHFRVLGPNRCVITTQKRTGVENV
TIQLDLEAEFHFTHLIMTFKTFRPAAMVIERSMDFGTTWQVYRYFAHDCEASFPGVPSGP
MAKVNEIICDSRYSDIEPSTEGEVIFRVLDPVFEIEDPYSLKIQNMLKITNLRVKFLKLH
TLGDNLLDYREEVTEKYYYALYDMVVRGNCFCYGHASECAPIDHGTPAAIEGMVHGRCVC
NHNTEGLNCERCQDFYQELPWRPAEGRNSHACKRCECNRHAASCHFDPAVYATTGGASGG
VCDDCRHNTAGRQCEQCAPFYYKHPNRDLRDPNVCQPCDCDPAGSLQGGLCDPRTDVAAG
LISGQCRCKANVEGERCDHCRQGHHGLGAEPHGCLPCTCNPLGTLPGGNPCDPDAGSCFC
KRLVGGHNCDACLPQHWGLSNDMDGCRPCDCDHGGAVHDDCDPRSGQCACREHMHGRRCD
RVQSGFYSVSLDHYTYEAEDAAHGPGVTVVPRPRPLDRSPTWTGPGFVNVPEGAYLEFTV
DNVPESMDYDVLIRYEPQLPEQWEQVDVRVQRPASTPQEHAPFCGGREDQDDQSVSLPPG
SRHVSLGRPVCLERGLNYTIRLTLPLYSSAGDVQSPYTLIDSLVLIPSVRELNMFHGLDG
DEAWDTFQRYRCLESSQSVIKSPLTDICNDYIFSVSALLHKGAVECRCDPQGSLSAVCEA
SGGQCRCRPNVAGRNCDRCAPATFLFGPTGCRPCGCDPLGSVGAFCHEATGQCCSHCLPG
RNQRFCCLFLAAALEMNSPQTRMHCKYCNKHCYTICIVVQKQYLAGKDCVSRICGALVQM
LISSRLHVKPEQHLRPPLTLKTPDSTPPPPGARCDECAPGYFGNPQVPGGRCLPCQCNSN
IDMHDPGSCDARTGACLKCLHHTEGYGCQQCRQGYHGDAAAQTCWKCTCDSAGTSPRACS
SPGECQCDRRSGQCPCLPNVVGQNCDACAADTWDMAGGAGCRRCDCDPVHSFGSSCDEVT
GQCSCRPGFGGKTCRECRELFWGDPQVKCHACDCDSRGISSGQCHRATGACTCAAGVSGP
RCDQCARGHRGDFPACEPCHRCFAAWDATVGELTNQTRRLEARVTRLRASRVTAPYKDLF
RSLERNADAVRGIVERKPAAELEQIQELMQQITGVMSYLNGKLNTTEETASLLRRDANAT
DANLGALSDAAEQLQRTVRELQQRVSDIKNANIQGAADTIAEARAQSVAAERSANTSTSG
PGSWVEQSAALRKAAEGKLSGARKEFDRRNQRNSEKLDKLSAALETLVLSPLSEATCGGA
AEGDGCSGSPCGGLGCGGEGGAPRCGGEGCGGLVAASHAALTSARDRDRQVVAAGHEVDE
LSRLVWEANNRANEAKVSALGALVGSNRSRERVEQSNQQLRSLIMEIRDLLSDEKANVSV
IEAVADEVLALKMPTSTQELRELTKEIREKVESLTSVEEILSQSAEDIGAAELLLRRAGS
ASKEASNTKEAADKMQAVLDETERAQSVATDALQLAQNNTNATRELLSSVESETAASELK
LGNTTGRLLQLDREVGLLRQNNLEVNRRVETANRTTDRARLDAAEAQQEFDEEVKGRLVT
VEDLVEDKGESALQGRTTAERLQKEAKELLAQSVSKLQRLEELERSYEANQLLLEAKAAE
LLELEVQARLALEAFSHKVMLYSTCA
Download sequence
Identical sequences G3Q9F2
ENSGACP00000026517 69293.ENSGACP00000026517 ENSGACP00000026517

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]