SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026647 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026647
Domain Number 1 Region: 371-497
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000361
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 2 Region: 307-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000112
Family EGF-type module 0.0048
Further Details:      
 
Domain Number 3 Region: 275-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000309
Family EGF-type module 0.01
Further Details:      
 
Domain Number 4 Region: 348-382
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000519
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026647   Gene: ENSGACG00000020172   Transcript: ENSGACT00000026699
Sequence length 566
Comment pep:novel group:BROADS1:groupVII:12730248:12733795:-1 gene:ENSGACG00000020172 transcript:ENSGACT00000026699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANLHLRYLLVLALLHVVSSSGVFELKINSFHTAQRICRRHRDCHIFFRICLKHPEDVIS
AEPPCTFGTGHTNVIRADHTSISSSAPIRVPFHFKWPGTFSLIIEAWNAESPTEYTDNQN
NLVSRLATRRRLAIGEDWSQDVHFGEQSELRYSYHVFCDEYYFGDGCAEYCRPRDDTLGH
YTCDEEGNRICLQGWKGNYCSEPICSADCSERHGYCEAPGGCTCRMGWQGPSCKECVRYP
GCLHGTCSQPWQCSCKEGWGGLFCDQDLNYCTNHKPCANGATCTNTGQGSYTCTCRPGYG
GTNCELETNECDSNPCKNGGSCNDLENDYSCTCPQGFYGKNCEIIAMTCADGPCFNGGTC
VEAVTGGYTCRCPPSYTGSDCEKKLDRCSNRPCLNGGECLDLGQSVLCRCQAGFTGANCQ
VNVDDCASTPCQNAGTCQDGVNDYTCSCTLGYTGKNCSVRSDACGARPCQNGGTCFTHFT
GPVCQCPKGFMGPSCEFTLQPSFKPALRQTSQPSSATLTVSCILAVLSLVLVAGIVLLRR
RRRRGLQGRKQLNDSAVYNDLETVNN
Download sequence
Identical sequences G3Q9T1
ENSGACP00000026647 69293.ENSGACP00000026647 ENSGACP00000026647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]