SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026657 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026657
Domain Number 1 Region: 357-543
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.74e-60
Family SPRY domain 0.0000105
Further Details:      
 
Domain Number 2 Region: 7-77
Classification Level Classification E-value
Superfamily RING/U-box 4.95e-17
Family RING finger domain, C3HC4 0.0053
Further Details:      
 
Domain Number 3 Region: 144-205
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.000000000000259
Family B-box zinc-binding domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000026657
Domain Number - Region: 217-280
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0667
Family Heat shock protein 70kD (HSP70), C-terminal subdomain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026657   Gene: ENSGACG00000020181   Transcript: ENSGACT00000026709
Sequence length 547
Comment pep:novel group:BROADS1:groupVII:12872551:12875169:1 gene:ENSGACG00000020181 transcript:ENSGACT00000026709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLAVPLEEQFKCCICLDIFTHPTSIPCGHNFCLECIEGFWDTKRKPECPLCKEKFKKRP
SLKINCGFAEIIEIYKSKRAQEERSRKNSLNPLCEADQVPCDVCCGDKSPSVKSCPTCLL
SYCELHLTPHEKDAALQKHQLMDTATFITTHLCGKHRKPLTKFCTSDQKPVCVKCTEREH
KHHTIVPIEKERNRVKTSLRDKKTSIKQMIHARRRKMEQINNSVDLSKKITEREIQGSAK
VCSLLITAIEKNQARLVEELEQKHQEAERRAAELLQELQQEIRELQARGIELVQLEQSQS
PVHLLQSFPSQSPLPSTREWSEVAVYSDHCMGAVTRAFSELIAVCQDLSDKLSEDEVDRL
NQYAVDVTLDPETASGWLVLSPDRKKVAVGSQKNNLVLDSPRRFNSCVCVSGKQSFATGR
RYWVVQVGNKTDWDLGVARESINRKGAIAVRPDSGYWAICRRKSSGLNACAGPSVKLCLK
ETPQKVGVFLDYDEGLVSFYDAEAKTHIYTYSGCDFNEPLNPYFNPCVPDEGKNIAPLII
CPVEESV
Download sequence
Identical sequences G3Q9U1
ENSGACP00000026657 69293.ENSGACP00000026657 ENSGACP00000026657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]