SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000026992 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000026992
Domain Number 1 Region: 188-397
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.2e-53
Family Reprolysin-like 0.0025
Further Details:      
 
Domain Number 2 Region: 486-542
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000327
Family TSP-1 type 1 repeat 0.00052
Further Details:      
 
Domain Number 3 Region: 866-927
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000432
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 
Domain Number 4 Region: 818-867
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000379
Family TSP-1 type 1 repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000026992   Gene: ENSGACG00000020418   Transcript: ENSGACT00000027044
Sequence length 927
Comment pep:novel group:BROADS1:groupVII:18219272:18228512:1 gene:ENSGACG00000020418 transcript:ENSGACT00000027044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METELCFPIRLDNHKHNRGDFDNDVEILNGKCVFKIRAFQQEFVIELHQDSNFIAPSISN
QDEFWLSNTDVTSDLRWCFYSGYVHADPHSYAALSLCKGLHGAFGFQGWEYFIAPVQNDT
TTAEGAHIIRRRTSNNLKLNSTSRCAVDTGISLQVARSLEKYKRLQDHDNVTETLLKKMG
RTKRFASIPRYVEALVVADESMVQFHGEDLNHYLLTLMSVAAKLYKHPSILNSINIVVVK
IVVISEEDKGPKVSGNAAMTLRNFCTWQKKMNHNNDKQRDYWDTAILFTRQDLCGASTCD
TLGMADVGTMCDPKRSCSVIEDDGLPSAFTTAHELGHVFNMPHDNVRACEDVFGKLQDNH
MMSPTLIQINRTSPWSLCSAAIITEFLDSGHGECLLDHPQKPLFLPDVMPGTSYVLERQC
ELAFGEDSKPCPFMQPPCGRLWCTGKSNGHLVCMTRHFPWADGTHCGDNQVCNQGVCSNK
QVPRVKVDGRWGRWGPFGSCSRTCGGGVQLSKRECSNPVPSNGGKYCQGVRVKYRSCSPN
QCTETGVGKTYREEQCASTGRSFNSNRIDPSVVWVPKYSGVSTDDRCKLICRANGTGYFY
VLAPKVVDGTPCSPDSTGVCVQGKCIKAGCDGKIGSTKKFDKCGICGGDSKGCKKVSGLF
TKPEHGYNFVVMLPLGAANIDIRQRGYKGMRSDDNYLAVKNSQGHYLLNGNYIVSAGERD
IIIKNSLLRYSGTAGLAETLQAVKPLGESLTVEVLCAGKMTPPRIRYSFYLARQAKEEKV
KKEERVNSHNSVLSEDSVKENGGDTLKKSYSKEEPSLGKWISTGWDQCSVSCGVGFQRRM
VQCLSADEKPWLDCDPSQRPPATRVCGDPCPDWHIGQWSPCSRTCGKGFKRRPLHCKNGQ
SGHLLPRDHCAGLRKPQELDFCNRMPC
Download sequence
Identical sequences G3QAS6
ENSGACP00000026992 ENSGACP00000026992 69293.ENSGACP00000026992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]