SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027133 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027133
Domain Number 1 Region: 28-282
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.59e-79
Family Protein kinases, catalytic subunit 0.000000000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027133   Gene: ENSGACG00000020520   Transcript: ENSGACT00000027185
Sequence length 1016
Comment pep:novel group:BROADS1:groupVII:19456498:19465945:-1 gene:ENSGACG00000020520 transcript:ENSGACT00000027185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSVRAGSLKDPEVSELFFKDDPEKLFSDLREIGHGSFGAVYFARDTRTNEVVAIKKMS
YNGKQSNEKWQDIIKEVKFLQRIRHPNSIEYKGCYLREHTAWLVMEYCLGSASDLLEVHK
KPLQEVEIAAITHGALQGLAYLHSHNMIHRDVKAGNILLTEPGLVKLADFGSASIASPAN
SFVGTPYWMAPEVILAMDEGQYDGKVDIWSLGITCIELAERKPPLFNMNAMSALYHIAQN
ESPRLLSSEWTDYFRNFIDSCLQKIPQDRPHSDDMLGHAFLQRERPDSVLMDLIQRTKDA
VRELDNLQYRKMKKILLQEAHNGPTAEAPDGDEDLEPGGGRTGTVNSVGSNQSIPSMSIS
ASSQSSSVNSLNEAAQDSRSELDLMEGDHTVMSNSSVIHLKPEEEESFSEEQAASSPPSE
PQPTPALAPRKHYRNREHFATIRTASLVTREMQEHEQDSELREQMSGYKRMRRQHQKHLM
GLENKLKGEMDEHRLRLDKELESQRNNFTQEMDKLLKKHQAALDKDLKTFTNDEKKFQQH
IQVQQKKELSSFLESQKREYKLRKEQLKEELSENQSTPKKEKQEWLSKQKENIQHFQAEE
EANLLRRQRQYLELECRRFKRRILIARHNVEQDLAREELNKRQTQKDLEHAMLLRHHESM
QELEIRHLGTIQRARAELIRTQHQTELTNQLEYNKRRERELRRKHVLEVRQQPKSLKSKE
LQIKKQFQDTCKTQTRQYKALRNHLLETTPKSDHKAVLKRLKEEQTRKLAILAEQYDHSI
NEMLSTQALRLDEAQEAECQDLRGQLQQELELLNAYQSKIKMQTDAQHDKERRELEQRVS
LRRALLEQKIEEEMLALQNERLERIRSLLERQAREIEAFDSESMRLGFSNMVLTNLASDS
QAGWGGGGGQGAQGGGHWSGGGGGGGGGGHHSHHHQGGSSSQQPWGHPMLAGGPPPWSLH
HPGGGNQRGSAGGAGGVRNSPQAMRRTSSGGRNDQGMSRSASITSQISNGSHLSYT
Download sequence
Identical sequences G3QB67
69293.ENSGACP00000027133 ENSGACP00000027133 ENSGACP00000027133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]