SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027313 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027313
Domain Number 1 Region: 895-1091
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.33e-37
Family Laminin G-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 693-882
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.69e-34
Family Laminin G-like module 0.007
Further Details:      
 
Domain Number 3 Region: 466-658
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-34
Family Laminin G-like module 0.00069
Further Details:      
 
Domain Number 4 Region: 283-461
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.76e-32
Family Laminin G-like module 0.0039
Further Details:      
 
Domain Number 5 Region: 1099-1310
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.11e-28
Family Laminin G-like module 0.00000355
Further Details:      
 
Domain Number 6 Region: 22-181
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.65e-26
Family Laminin G-like module 0.0047
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000027313
Domain Number - Region: 205-237
Classification Level Classification E-value
Superfamily EGF/Laminin 0.014
Family EGF-type module 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027313   Gene: ENSGACG00000020651   Transcript: ENSGACT00000027365
Sequence length 1665
Comment pep:novel group:BROADS1:groupVII:21762041:21835045:-1 gene:ENSGACG00000020651 transcript:ENSGACT00000027365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IVAIMGRCTGEAAWLLLLAGLLLSAVALEYEGVPGQWTRYGQWDAKATGELSFILKTNTS
KALVLYLDDGGNCDFLELLIADGRLHMRFTIHCAEPASLHTETRIDDLRWHRVLLSRDHR
ETRLVVDNEEKVAEVKSKRNEMVVASDLYVGGISPDVRLSALTSSTVKYEPPFRGLIANL
KLGEALPLLLDGQAVHSDLEYICITHSPCGKKGLCSVSKGEVVCDCINTGYTGRYCNEGE
KEVEGLAHLMLNRQGMGSIVFRQAGTGTGGLMDVSPPLSGQEESVATFKGNEFFSYNLSQ
TPIQSSLDEITMSFRTLQRNGLLLHTGRSADYVNLSLRNGALWLVINLGSGAFEALVEPA
KGKFNDNVWHDLRVTRNLRQHSTIAHFCSSVSVCVFVVTILVDGILTTTGYTQEDYTMLG
SDDLFYIGGSLNTADLPGSPVSNNFLGCLKDVVYKNNEFRLALSRLAEQQDPKISIHGDL
KFSCQDVEALEPVTFDTPSAYLTLPRWNTKKTGAISFDFRTTEPAGLLLFSHGSLQGARP
NRKPRADFFAMELLDGFLYLVMDMGSGSIKMKASNKRLDDGEWCHVDFQRRGRNGFISVN
SKSVPFSANEGSEILDLDGDMYLGGLPDDRQTLMLPPEVWTASLNLGYVGCVRDLFIDGQ
SRNLWRLAEVQSATGVSSFCTRETHVRCARDTCANGGHCREGWNRHICDCNVTGYLGPSC
EKEATVVSYDGSMYLKVVMPRTLHTEAEDVSLRFMSQRAFGLLMASTSQQSADTLRLELD
GGRVKLTVNLDCIRIDCNLSKGPEVLLVGEKLNDNEWHTVKVVRRGKNLQLSVDNVTVEG
HMTGAHTRLEFSNIETGIMTERRFISVMPSNFIGHLQALSFNGMLYLDQCKNGDISYCEL
NARFGMRHIVANPVTFLAQASYLAFSTLQAYASMHLFFQFKTTSPDGLILYNSGDGSDFI
VVELVKGYIHYVFDLGNGPSLMKGNSDKPLNDNQWHSVVISRDNNNVHILKIDSRTVTQH
ANGARNLDLKGELYVGGVGKSMYSSLPRLIASREGYQGCLASVDLNGRLPDLLADALHKV
GEVEHGCGGPSTTCTEDSCHHQGVCLQLWEGFSCDCTMTTYGGPFCSDPGTTYIFGKGGA
LITFTWAPNERPSTRADRLAVGFSTQQKDAILVRVESTHGLGDYLQLHVDQGKIGVIFNV
GTDDITIDEPAVMVNDGKYHVVRFTRSGGNATLQVDNHPVIERYPPGHFDNERLAIARQR
IPYRLGRVVDEWLLDKGRQLTIFNSQAAIKIGGHDKGRPFQGQISGLYYNGLQVLKLAAE
NDPSVQVEGNLRLVGDSLSVLTTDTTSATPLAVSDMRRQRSPSLRESISKPLNSDDILVA
SAECPSDDEDLEECEPGTGGELVLPIITVDSLEPPSIATRYPVIPPPPTLLSPLETTKES
LILPPHPSCPPDQEDCGDPVEVSAFGSGELTESDDEDFYNNKSPMVTDRTVLPPPPTAGE
GGARKPRPLPPYVPTTNPDQLHIPAGKMNTRDQVLLPPAPPSSRNTPGLTYPPNFPHVPT
ANPTASDEKSQPGAVEVIREASSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQAD
QSNSFANSSAVEGNGAVVKDKSTPTASAAKAITKGKKNKDKEYYV
Download sequence
Identical sequences G3QBP7
ENSGACP00000027313 ENSGACP00000027313 69293.ENSGACP00000027313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]