SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027317 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027317
Domain Number 1 Region: 158-252
Classification Level Classification E-value
Superfamily Immunoglobulin 5.54e-20
Family I set domains 0.013
Further Details:      
 
Domain Number 2 Region: 263-304
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000298
Family EGF-type module 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000027317
Domain Number - Region: 46-127
Classification Level Classification E-value
Superfamily TIMP-like 0.0183
Family Netrin-like domain (NTR/C345C module) 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027317   Gene: ENSGACG00000020654   Transcript: ENSGACT00000027369
Sequence length 730
Comment pep:novel group:BROADS1:groupVII:21884931:21941223:-1 gene:ENSGACG00000020654 transcript:ENSGACT00000027369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQPREPCRNATSDHRAKAGGMRLDSVHLSMLVIGVSFACYSPSLNSLQDQVYKSAVVIEG
KVQSTPVNVSAQRYRVNVKVLDVWPLNSGGLKREQLVAVGEFGSEPPCTKVKKNHKYIFF
MDPTDEPLVFKASFAPRDTSVRNLKKDVGKILCEDCAAAPKLKPMKNPIIVGEGSRLVMK
CEAKGNPLATTYKWFKDGSELKKSKKIKIRSSLKNSRVQITPAKLEDSGNYTCVMENPLG
RDNSSSTVNVQTITTTPSSVPGHARRCNATEKAYCVNGGDCYFYHGINQLSCKCRDGYFG
PRCLQTEPTAAAHASPKQSTCQTVLTEAEELYQKRVLTITGICVALLVVGIVCVVAYCKT
KKQRKKMHNHLRQNMCPEHPNRNLANGPNHPGPGPEEIPMVDTQYISKNLPATERVTRHP
TEGSFPASHASSRSHNSSTRAHSSTHRHEERTWSLEHSDSILSDSPGMMSSSVGTSKCSS
PACMDCGYSDPRRPGLQYGDSFDSLGDSPHSDRYVSALTTPARLSPVDFHYSLPSQVPTF
QITCPNASHAMSLPPAVHNPYPLEDDQPLLRRYQVPLHDAQCQEPYRQQRRTYLNDSRGS
LPSSPYRLAKEEDYETTQEYLSSREQPKRSGSSGTGNRRWQRSRLNGHVAPRGYEASRDY
GSRSCLTDSESEEDGESTPFLSMQNMNAEPSTIYRPVDSRTSHSSGRHSGHGNMHTRLTH
SRSKPDNTPH
Download sequence
Identical sequences G3QBQ1
ENSGACP00000027317 69293.ENSGACP00000027317 ENSGACP00000027317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]