SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027327 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027327
Domain Number 1 Region: 223-398
Classification Level Classification E-value
Superfamily MIR domain 5.75e-50
Family MIR domain 0.0026
Further Details:      
 
Domain Number 2 Region: 1084-1199
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.28e-17
Family SPRY domain 0.04
Further Details:      
 
Domain Number 3 Region: 666-800
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000095
Family SPRY domain 0.053
Further Details:      
 
Domain Number 4 Region: 4074-4152
Classification Level Classification E-value
Superfamily EF-hand 0.00000107
Family Calmodulin-like 0.037
Further Details:      
 
Domain Number 5 Region: 1423-1548
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000158
Family SPRY domain 0.025
Further Details:      
 
Domain Number 6 Region: 106-189
Classification Level Classification E-value
Superfamily MIR domain 0.0000102
Family MIR domain 0.023
Further Details:      
 
Domain Number 7 Region: 440-556
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000327
Family IP3 receptor type 1 binding core, domain 2 0.016
Further Details:      
 
Domain Number 8 Region: 2218-2288
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.000051
Family IP3 receptor type 1 binding core, domain 2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000027327
Domain Number - Region: 559-633,1984-2302,2630-2670,2707-2741
Classification Level Classification E-value
Superfamily ARM repeat 0.0276
Family PBS lyase HEAT-like repeat 0.092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027327   Gene: ENSGACG00000020663   Transcript: ENSGACT00000027379
Sequence length 5031
Comment pep:novel group:BROADS1:groupVII:22076558:22115269:1 gene:ENSGACG00000020663 transcript:ENSGACT00000027379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGADGEEEIQFLRTDDQVVLQCTASILKEQIKLCLSCEGFGNRLCFLETTSNAQNIPP
DLAICCFILEQSLSVRALQEMLSNSSVDEAVDLDKWSSQGGGHRTLLYGHAILLKHTHSS
MYLCCLTTSRSLTDKLAFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRVGDDLILVSVS
SERYLHLSYASGDLMVDASFMQTLWTMTPVMSGCELVEGFLTGGYVLRLFHGHMDECLAI
PGADQGDDQRRVAHYEGGAVCSHARSLWRLEPLRIAWSGGHIKWGQSFRIRHITTGRYLC
LDEEKGLLLVDPEKANSKMSAFCFRISKEKIEVIQKRDVEGMGTPEIKYGESMCFVQHVS
TGLWLTYAAVDAKSARLGPLKRKAILHKEGHMDDALTVARSQTEESQASRMIFSTSGLFN
QFIKGLDALGGKNKSAGSTSLPMDTVVLSLQDLIFYFRPPEEELEHEDKQFKLRSLKNRQ
NLFQEEGMITHVLDCVDRLNVYNTAAHFSEYAGEEAAESWKEIVNLLYDLLASLIRGNRA
NCALFCDNLDWLVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGR
NHKVLDVLCSLCVCNGVAVRSNQNLITENLLPGRDLLLQTNIINYVTSMRPNIFLGTCEG
STQYKKWYFEVMVDEVEPFLTAQPYHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYG
FDGLHLWSGRVSRHVATPNHHVLAAEDVVSCCLDLSVPSISFRINGHPVQGMFENFNLDS
LFFPVVSFSAGVKLRFLLGGRHGDFKFLPPPGYAPCYEAVLPRDRLRIEPIKEYKHDFEA
VRNLLGPTQSLSHTAFTPGPVDTIQIVLPPHLERIREKLAENSHELWAVTRIEQGWTFGP
FRDDNKKLHPCLVDFQSLPEPEKNYNLAMSGETLKTLLALGCHVGMGDEKAEENLKKTKL
PKTYMQSSGYKPAPLDLNHVKLTPNQNTLVERLAENGHNVWARDRVRQGWTYSIVQDIMN
KRNPRLVPYNLLDEKTKKTNRDTVFAAVRTLIGYGYNIEPPDQESSGLGPESGDKIRVFR
AEKSYAVTQGKWYFEFEAVTVGEMRVGWARPSVRADTDLGADEFAYVFNGFKAQRWHVGN
EPFGRQWLSGDVVGCMIDLTEMNIMFTLNGEMLISDSGSEMAFKDIEIGEGFIPVCSLGL
SQIGRINLGQNVSSLRFFTICGLQEGFEPFAINMKRDITMWFSKSLPQFINAMDHPHVEV
SRVDGTVESAPCLKVTHKTFGSQNANTDLLFFRLSMPVEFHETFKVPAGTTLLTRALTIP
EDEVLEVDPDSDFEILKKSATRKEQEEEKKEPSVPKEIPAIKNGENEKDASTEKSKKKGF
LFKAKKAALINPPPVVPAMPRLVEDVVPDDRDDVDIILNTTTYYYSVRVFAGQEPSGVWV
GWITPDYHQYDPHFDISKVRNVTVTVGDDKGNIHDSIKRSNCYMVSGGEFGSSQQTRVSQ
EDFVIGCLIDLEAGLMTFTANGKEINTFYQVEPNTKLFPAVFVLPSSQNMIQFELGKLKN
IMPISAAMFRSERKNPVPQCPPRLDVQMLTPVIWSRMPNHFLAPDTGRVSERLGWVVHCR
EPLTMMALHIPEESRCIDILELSEHMDLLKFHYHTLKLYGLVCALGNNRVAHALCSHVDE
SQLFYAIEDTYLPGPMRSGFYDLLISMHLESAKRNRLGTNKEFIVPMTDETRSITLYSDK
SHALPGVGLTTCLRPKLHFSSIGFVGTDQDIYTLSPVIPLQVLKTKALNMLTEAVQDGVQ
AMRDPVGGSVEFHFVPILKLISTLLIMGVFDDEDVTHILKMLEPTVFSGKQAEEPTEENV
NVKEQKEQKTTPKEGVMQEDQQESIFEDDGLGEDGEEEMEGDEKLQTDSIVPHEGKVDET
DQVNGEKGAEETEKEIKEENKEEHLEQGLFQMKLPESVKLQMCTLLQYFCDCELRHRVEA
ITSFSDQFVSHIQCNQRHRYNELMLAFTMSAAETARKTREFRSPPQEQVNMLMNFKNCSE
DDECPVPDEVRDALMTFHNALLGHCGVHIEEEEQEEEVDNSVRGRLVRLLEKVKRIREKK
VEVEPEPQEDKKPSTLQELISHTMIHWAQESFIQNPELVRMMFSLLHRQYDGLGELMRAL
PKAYTINAVSIHDTMDLLECLGQIRSLLIVQMGPEEERLMIQSIGNIMSNKVFYQHPNLM
RALGMHETVMEVMVNVLGGGDSKEIRFPRVVTNCCRFLCYFCRISRQNQRSMFDHLSYLL
QNSGIGLGMRGSTPLDVAAASCIDNNELALALQEQDLEMVVKYLAGCGLQSCPMLLSKGY
PDIGWNPCGGEKYLDFLRFAVFVNGESVEENANVVVRLLIRRPECFGPALRGEGGNGLLA
AIEEAIKISEDPARDGPSVKKDRRFPMFGGEEQQEENRVHLGNAIMSFYSALIDLLGRCA
PEMHLIQAGKGEALRIRAILRSLVPIEDLVGVISLSVQIPSFGKDNSIIEPKMSASFVPD
HKAPMVLFLDRVYGIDNQDFLLHVLEVGFLPDMRAAASLDTVAFGTTEMALALNRYLCSA
VLPLITKCAPLFAGSDHRAIMIDSMLHTIYRLSRGRAFTKAQRDIIEECLMALCKHLRPS
MLQHLLRRLVFDVPILNEYAKMPLKLLTNHYERCWKYYCLPNGWANFGVSSEEELHLTRK
LFWGIFESLAHKKFDAEIFKISMPCICAIAGAIPPDYVDASYSSKTEKKASVDAEGNFDP
KPVETTNTIIPERLDSFINKYAEYTHDRWAFEKIQNNWSYGEALDENAKTHPMLRPYKTF
SEKDKEIYRWPIKESVKAMIAWEWNLDKAREEDESDKKKAVSRKISQTAQATYDPSHGYS
PQPIDISHMALSRDLQSMAEQLAENYHNTWGRKKKLELQSKGGGTHPLLVPYDTLTAKEK
ARDREKAHELLKFLQLNGYACTRGLKDMESDISSIEKRFAYGFLQKLLKWMEIAQEFIAH
LEAVVSSGRVEKSPHEQEIKFFAKILMPLINQYFKNHCLYFLSTPAKVLGSGGLSSNKEK
EMIASIFCKMSALVRHRVSLFGTDASAIVNCLHILARSLDARTVMKSGPEIVKAGLRSFF
ESAADDIEKMVENLKLGKVSKGNQQVKGVSQNINYTTIALLPVLTSLFDHIAQHQFGDDV
MLDDLQMSCYRIMCSIYSLGTVKNPHVERQRPALGECLAHLAAAMPVAYLEPHQNEYNAF
SVYTTKTPRERAILGLPNEVQELCPDIPELDALLKEIGDLAESGARYTEMPHVIEITLPM
LCNYLPRWWERGLENFPEMEGQICTDVTSEHLNQLLGSIMKIVVNNLGIDEASWMKRLAV
FSQPIVSRAKPEMLKSHFIPTMEKLKKRTSKVVAEEDHLRMEGKSEGDEEDGTIRDEFAV
LCRDLYALYPLLIRYVDNNRARWLTCPDPDAEELFRMVGEVFIFWSKSHNFKREEQNFVV
MNEINNMSFLTADSKSKMSKGGDSEGGGSDTERTKKKRRGDRYSVQTSLIVAALKKMLPI
GLNMCSPADQELINLAKIRYSLRDTDEEVREFLQHNLHLQGKVDNPSMRWQMALYKEMAG
KAEDADAPMKVVKRVQEVSAVLYHLEVTEHPFKSKKMVWHKLLSKQRRRAVVACFRMTPL
YNIPRHRASNMFLEGYKRNWLHSEGYSFEDRMIDDLSKAMEQEEGDEEEERETKPDPLHQ
LILHFSRTALTEKSKLDTDHLYMAYAEIMAKSCHIGEEEEGGEEMVENAEDEMSFEDKEM
EKQRLLYQQSRLHNRGAAEMVLQMISACKGETGPMVTTTLKLGISILNGGNNVVQRKMLE
YLRDKKDVGFFLSVQALMQTCSVLDLNAFERQNKAEGLGMVSEEGSNEKVMSDDEFTCDL
FRFLQLLCEGHNNADFQNYLRTQTGSTTTINIIICTVDYLLRLQESISDFYWYYSGKDII
DEPGKKNFSKAMTVAKQIFNSLTEYIQGPCTGNQQSLAHSRLWDAIVGFLHVFAHMMMKL
AQGKKDSSQIGLLKELLDLQKDMVVMLLSLLEGNVVNGTIARQMVDMLVESSSNVEMILK
FFDMFLKLKDIVASDAFRDYVTDPRGLISKKDFQKAMDSQKQYSHSEIQFLLSCSEADEN
DMIHYEEFANRFQEPAKDIGFNIAVLLTNLSEHVPHDVRLQNFLEQADSVLNYFRPFLGR
IEIMGASRKIERIYFEITEVNRKQWEMPQVRESKRQFIFDVVNEGGESEKMEMFVNFCED
TIFEMNIASQICDEDSNGEEGQPESSSAFADFVNSVLCFFSIFTFRNLRRQYRRVRKMSF
KEIVVALSTFFWTILMSILHFIYNVCKGFFMIIWQTLFGGGLVEGAKNITVTEILASMPD
PTQDDVHGDGPGEPRTEEQDTGGVTDTGETGSGEEEEEDSQEKEGGRVAGVDAPGGLGDM
GVESTVEPPTPEGTPITKRKVPPEETEASQKPPEPVEEPPPKPEKADVSVENAEKESQSK
EEEKPEERKKSPKKKEKKPKREGGFQIWNELENQRNKFMNYLSRNFYNLRFLALFLAFAL
NFILLFYKVSDSPPEGEEMEGSGLSEGSGLFEGSGFFEGSGEEAEGSGMNEGDEDEEEVA
IYFYLEESTGYMQPTLTFVAALHTVISFICIIGYNCLKIPLVIFKREKELARKLEFDGLF
ITEQPEDDDIKGQWDRLVLNTPSFPNNYWDKFVKRKVLDKYGDIYGRERIAELLGVDLAS
LDVSQQHEKKQEEPDTSVFSWTTTIDIKYQIWKFGVVFTDGTFLYLCWYTIMSLLGHYNN
FFFACHLLDIAMGVKTLRTILSSVTHNGKQLMMTLGLLAVVVYLYTVVAFIFFRKFYNKG
EEEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIV
ILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLDEHNLA
NYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFYPAGDCFRKQYEDQLS
Download sequence
Identical sequences G3QBR1
ENSGACP00000027327 69293.ENSGACP00000027327 ENSGACP00000027327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]