SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027526 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027526
Domain Number 1 Region: 2-311
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.16e-60
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000781
Further Details:      
 
Domain Number 2 Region: 318-457
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.21e-32
Family Ricin B-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027526   Gene: ENSGACG00000020820   Transcript: ENSGACT00000027578
Sequence length 460
Comment pep:novel group:BROADS1:groupVII:25988105:26010733:-1 gene:ENSGACG00000020820 transcript:ENSGACT00000027578 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKRKLYAEKLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPQLLAEVILVDDFSDKEHLKV
ALEEYMVRLPKVRILRTKKREGLIRTRLLGAAAAKGEVITFLDSHCEANVNWLPPLMDRI
AQNRKTIVCPMIDVIDHDNFGYETQAGDAMRGAFDWEMYYKRIPIPARLQNGDPSEPFES
PVMAGGLFAVDRKWFWELGGYDTGLEIWGGEQYEISFKVWMCGGRMEDTPCSRVGHIYRK
YVPYKVPGGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDMTAQKELRSRLNCRN
FKWFMSEVAWDLPKHYPPVEPPAGAWGEIRNAGSGNMCMESKHFTSGSPVRLESCAKGRA
EVSWGHGQVFTFGWREDIRVGDPMHTKKVCFDAVSHNSPVTLYDCHGMRGNQLWRYREDK
SLYHAVSNSCIDCSPSERRVFMNTCDPSSPSQRWLFERTN
Download sequence
Identical sequences G3QCB0
ENSGACP00000027526 ENSGACP00000027526 69293.ENSGACP00000027526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]