SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000027650 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000027650
Domain Number 1 Region: 200-401
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.16e-45
Family Reprolysin-like 0.002
Further Details:      
 
Domain Number 2 Region: 495-544
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000746
Family TSP-1 type 1 repeat 0.00037
Further Details:      
 
Domain Number 3 Region: 910-960
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000785
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 785-846
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000667
Family TSP-1 type 1 repeat 0.0056
Further Details:      
 
Domain Number 5 Region: 846-907
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000562
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000027650   Gene: ENSGACG00000020910   Transcript: ENSGACT00000027702
Sequence length 1134
Comment pep:novel group:BROADS1:groupVII:27808361:27828622:-1 gene:ENSGACG00000020910 transcript:ENSGACT00000027702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PIRTNSEGRFLPATVSGLHLPRRKRHYASPRPPRLEGTELFYNVTVFGQELHLRLRPNGR
LVAPTAIMEWWEESGHKTSQPIRDTDCLYTGEVSNMEDASIAISNCDGLAGVIRTSQEEF
FIEPLNPWRTRGKEEEEKGDRPHIVYRSSALSCQTGLDQRTVTAFNVDSPDSIGLQNYIL
GKQKNSSRKPGRDAALYDLYSIEVLLAVDYSVLLFHGRDHIQKYLLTLMNILNEIYQDHS
LGANINVVLVRIIMLSPSKSQELISVGNPQKSLENVCGWSYLQHREQNDAEQHDHTIYLT
RQEFGPSGMQGYAPVEGMCQLHRSCVLVFEDGFSSAFVAAHETGHVLGMQHDGEANDCAD
DVPMGSIMSPRVQATFQRYHWSRCSWRELHQHLQTYDCLRDDPFNHDWPAQPPLPGFQYS
MDQQCRFDFGPGYSSFCPKYATHDPCKQLLCSEYNNPFHCKTKKGPPLDGTKCGPGKHCF
KGFCLKLTPDMLRQDGGWGAWSPFGVCSRTCGGGVRFRARRCDSPAPANGGRTCFGNSYE
FQMCSQGECPPLTDFRREDQCKLWNPFLEHEGRKHHWLPYQHPDPDERCILHCQSKETAA
VVSINRMVHDGTPCSYGDAHSVCVRGECEHVGCDGQIASDKQEDRCGVCGGDNSSCKIIK
GNFTRSTKKQGYLKILEIPKGARHLLIQEFKGTPHILALTNQETGELFLNSEDKVPASRV
VIQRGVFWEYKNTEEQESVQTTGPLTYDVLLLVRSHGDSKLTVSYKYIIQDGLRSLLESN
LLQDDGVFYEWALKKWSHCSKPCGGGKQYTRFGCRRKADGKMVQRTFCSKTGKPRAISRS
CSTDTCNSPRWLTGEWQDCSATCGQTGWQRRWVSCQQTSSRGQHSVPSKLCGEERPEGKQ
TCNRFPCPASWRAGPWTPCSVSCGNGTQERQVACLSPDGSARNCSDFPPIKTRNCHPPPC
SGDQKNAIIQWLSRSNPDFSASKIFSSQRCRGDRSVFCRMEVLSRYCSITGYRQMCCKSC
TTAFVVIAGSQSATAPPPTTPSTDPNDVFTVTLGGRSLRTGAKPLQTSSSFFPLSKRENS
VDVVPYRIVGLDHDTTEKQSYFVPRMPPIRERTQNKRIQQLLNEKRRKDVAKRA
Download sequence
Identical sequences G3QCN4
ENSGACP00000027650 69293.ENSGACP00000027650 ENSGACP00000027650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]