SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000000991 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000000991
Domain Number 1 Region: 154-356
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.16e-51
Family Prokaryotic proteases 0.00000123
Further Details:      
 
Domain Number 2 Region: 392-487
Classification Level Classification E-value
Superfamily PDZ domain-like 8.68e-20
Family HtrA-like serine proteases 0.0036
Further Details:      
 
Domain Number 3 Region: 26-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000926
Family Growth factor receptor domain 0.0019
Further Details:      
 
Domain Number 4 Region: 89-136
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000222
Family Ovomucoid domain III-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000000991   Gene: ENSGACG00000000768   Transcript: ENSGACT00000000991
Sequence length 491
Comment pep:novel scaffold:BROADS1:scaffold_47:363093:374729:-1 gene:ENSGACG00000000768 transcript:ENSGACT00000000991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMHILLYAAVFLYLKESAFAKPKDKCPTRCDVSTCPSPGCPSGYVPDRCNCCLVCAQAEG
EPCGRKDDLPCGDALECKHPAGKRLSKGFCRCRFRQDVCGSNGKTYGNVCQLKATSRKAL
QQGLPAFNLAHKGPCDNSTASIGPSHADSPRYKFNFIADVVEKIAPAVVHIELFLRHPLF
GRNIPLSSGSGFLLSDNGLIVTNAHVVSSTTPVSGQQHLKVQMHDGHVYEANIKDIDKKS
DIATIKINSQMKLPVLFLGHSADLRPGEFVVAIGSPFALQNTVTTGIVSTAQRDGKELGL
KDSDMDYQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPADRITLFLNDSLDK
HNKGVSDSDVIGPGLNIFKLESLSDVRSIKKRFIGISMLTITPALIEKLKQQNLDFPDVT
SGIYVHGVIPHSPAQKGGIKEGDIIVKLNGKSLMATADLQEALQEETALLLEVRRDNDDL
LFNIEPDVIMQ
Download sequence
Identical sequences G3N6R6
69293.ENSGACP00000000991 ENSGACP00000000991 ENSGACP00000000991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]