SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000001662 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000001662
Domain Number 1 Region: 71-166
Classification Level Classification E-value
Superfamily SH2 domain 1.25e-22
Family SH2 domain 0.00013
Further Details:      
 
Domain Number 2 Region: 205-244
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000017
Family SOCS box-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000001662   Gene: ENSGACG00000001275   Transcript: ENSGACT00000001663
Sequence length 245
Comment pep:novel scaffold:BROADS1:scaffold_27:3572238:3573823:1 gene:ENSGACG00000001275 transcript:ENSGACT00000001663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MILCVPGLNVLIKCSCQQLKAKPNFSPRASLPGALSTESPRGMRAGAAPSTPCLQSTPPP
WDPTKDLRAIASNFCYLENSGWYWGAVTAAQAHAALQEASEGAFLVRDSSHPLYMLTLSV
RTARGPTSIRIQYSGAMFLLDSSSPARPTLSSFPNVPSLVQHYMGPERQAEEGKVVEDAP
SKPSQQTIQETSVVLKLKRAVFKPQGLPSLQHLTRLVINRHSDCPEQLPLPRPLLRYVQD
YPFKV
Download sequence
Identical sequences G3N8M6
69293.ENSGACP00000001662 ENSGACP00000001662 ENSGACP00000001662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]