SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000002886 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000002886
Domain Number 1 Region: 46-284
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.28e-36
Family Ankyrin repeat 0.00041
Further Details:      
 
Domain Number 2 Region: 303-348
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000157
Family SOCS box-like 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000002886   Gene: ENSGACG00000002222   Transcript: ENSGACT00000002896
Sequence length 360
Comment pep:novel group:BROADS1:groupXVI:4487126:4491407:1 gene:ENSGACG00000002222 transcript:ENSGACT00000002896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADGPRADDDHPPRTRSPPLITVSDLPSATAAGQNLKEWLQEQFCDKPLEQDDMRLHNAA
YVGDLDTLRSLLQEDCFRRRINEKSVWCCGCLPCTPLRIAATAGHAACVAYLIGQGAAVD
LVDVKGQTALYVAVVNGHLDCVRILLQAGADPNGSRHHRSTPLYHAARVGSLDVLQELIR
FKADVDMDHQLGPRLLLSARTLNTLVVCPLYISAAYHHLHSFRLLLQAGAQPDFNYTGPV
CRETLTRGLASCLLDAVLRHGCEAAFVHLLLDHGADPALVPWDGLELEGPNRRKVDPEAL
SVFLEARRCPRRLTNLCRIGIRRAMGKNRLHHITSLPLPKTIKNFLLHQNGQPELFPPKA
Download sequence
Identical sequences G3NC37
ENSGACP00000002886 ENSGACP00000002886 69293.ENSGACP00000002886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]