SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006183 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006183
Domain Number 1 Region: 32-225
Classification Level Classification E-value
Superfamily L domain-like 3.74e-36
Family Ngr ectodomain-like 0.0022
Further Details:      
 
Domain Number 2 Region: 242-340
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000683
Family I set domains 0.044
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000006183
Domain Number - Region: 492-524
Classification Level Classification E-value
Superfamily Fibronectin type III 0.021
Family Fibronectin type III 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006183   Gene: ENSGACG00000004691   Transcript: ENSGACT00000006200
Sequence length 686
Comment pep:novel group:BROADS1:groupXIX:6319533:6321650:1 gene:ENSGACG00000004691 transcript:ENSGACT00000006200 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLQLLALWTTVVGNVQCCPELCSCQDKHTHQIADCAYKELQEVPEGLPSNVTTVSLSANK
IKLLKSKSFIDITQVSSLWLAHNEIVTIETDTLAPLIQLRNLDISYNKIVDFPWEDLRNL
TGLQLLRMNNNEMVNLPKDAFTNLKDLRSLRINHNKFTVIEQGTFSALSSMSHLQIFDNP
FTCSCNLEWLRDWITTTKISVPSPNLITCEAPEHLKGTMVTLIPKLDCVAPTVKISSEPN
VENTEISEGLMVILNCETTGSPTPQISWEVTAGNQNFLFPLPSTGEMNDVPINDKTTNGR
FLVFRNGSLIVPRMSKREDGDYSCSAGNDLGRAESSVKLAMAVTQKHGIDSKPDSTLEKI
RPSVKKPAEAGSSINNVINWTKPDGKPKGGPEGPFDKSAGTGQVVKEHTFASKCGVRESS
EYISNHAFNLSLEDLKQYTFDSGVIALEVSETEAKVQLNPLQLPSSKSNLHSSSSKVTLN
MLYLCVNTGNGHSMVQWSNIEEGVNAYRFHGLHPGTNYTLCLTHGGQDCQVQVVFTTRKK
IPSLLIIVVVSIFLLGLATVPLFGATCCHLLYKYQGKTYKLIMKAQNPDQMEKQATEDFD
PRASFVESEKTFDPSELGEGEGEADGEEGDGEADGSVVTESIPGSSSKTNPEEFEVGSEY
SDKLPLGAEAVNISEEINGNYKQPSR
Download sequence
Identical sequences G3NLH0
ENSGACP00000006183 ENSGACP00000006183 69293.ENSGACP00000006183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]