SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006193 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006193
Domain Number 1 Region: 2-111
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.45e-22
Family alpha-D-mannose-specific plant lectins 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006193   Gene: ENSGACG00000004701   Transcript: ENSGACT00000006210
Sequence length 116
Comment pep:novel group:BROADS1:groupXXI:10060951:10061397:1 gene:ENSGACG00000004701 transcript:ENSGACT00000006210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKNYLSKNDELRKGDFLISNNREWKAVFQEDGNFVIYGWKPFWSSDTSGSDGMRVCMQA
DCNLVMYNKSDQPQWHTNSSKPKCNMCRLHLTDEGKLVVSRESDEIWNSDKDKGMK
Download sequence
Identical sequences G3NLI0
ENSGACP00000006193 ENSGACP00000006193 69293.ENSGACP00000006193

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]