SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000006365 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000006365
Domain Number 1 Region: 42-102
Classification Level Classification E-value
Superfamily GLA-domain 7.06e-23
Family GLA-domain 0.00051
Further Details:      
 
Domain Number 2 Region: 87-133
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000737
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 128-175
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000152
Family EGF-type module 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000006365   Gene: ENSGACG00000004822   Transcript: ENSGACT00000006382
Sequence length 245
Comment pep:novel group:BROADS1:groupI:514072:517686:-1 gene:ENSGACG00000004822 transcript:ENSGACT00000006382 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLMWTLCTLLTCFPLVTCTVFLDRPSAGQVLGSSARRRRANAFFMEEMLPGDLERECHE
ETCSQEEASEIFQSSEKTLEFWYKYTNLNPCRTNPCLNGGMCTLDRGDFLCLCSPQYHGK
TCDSVVLECRYRNGGCMQYCRDLLGDGVRCGCADGFRLEEDGRSCSKSVSFPCGRQHRDF
SLYQSRSLWSQTEQINTHMRDDNTTINTTNNNNTNWLADPDVVETEEELVTVNSTSGQRG
SNETE
Download sequence
Identical sequences G3NM02
ENSGACP00000006365 69293.ENSGACP00000006365 ENSGACP00000006365

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]