SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000007201 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000007201
Domain Number 1 Region: 27-240
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-34
Family Ankyrin repeat 0.00051
Further Details:      
 
Domain Number 2 Region: 257-306
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000876
Family SOCS box-like 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000007201   Gene: ENSGACG00000005453   Transcript: ENSGACT00000007219
Sequence length 326
Comment pep:novel group:BROADS1:groupV:6709676:6711794:1 gene:ENSGACG00000005453 transcript:ENSGACT00000007219 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LASSTGSMLRLRTSAEERSSCEIAQLRQAVLQNDDRLLDEMLCQEVYKKVINCRGGWGIA
GTPLHAAVSKGHLSCLQVLLGHGALVDCVDVKAQTPLFAAVRGKYLDCVLALLRAGANPN
GNASNNCSPVLTAAREGDVEILKELLRRGAEVNSRSKVLLWTSSARVSSGPLYLAAVYGH
MECFKLLLLYGADPDYNCTDAKLLGSIKQPKTVLEMCLRHGCGVEYIQLLIDFGANVYLP
TLIIEKSTKQNEAVELLLEERGNPKALTSQCRLSVRRYLKKINRIHRIDKLDLPTRLINF
LQHRPAPVTLPWPAEPKAPRCEFIVI
Download sequence
Identical sequences G3NPD7
69293.ENSGACP00000007201 ENSGACP00000007201 ENSGACP00000007201

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]