SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010350 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010350
Domain Number 1 Region: 32-239
Classification Level Classification E-value
Superfamily L domain-like 4.48e-34
Family Ngr ectodomain-like 0.0072
Further Details:      
 
Domain Number 2 Region: 291-362
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000521
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010350   Gene: ENSGACG00000007812   Transcript: ENSGACT00000010372
Sequence length 494
Comment pep:novel group:BROADS1:groupXII:10069059:10070543:1 gene:ENSGACG00000007812 transcript:ENSGACT00000010372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TVPHWSECPGWVLSLTLCMALLWLPGAAASTLNCHKTCICASNIVSCSKMNLTTVPTGLP
LYTAVLDLSYNEIDRLRSEWTPVKLLKLHNLLLSHNGLHFLSSEAFHNVKQLRYLDLSSN
NLQLLDEFIFEPLVNLEVLLLYNNQVSQIDRSAFLGMINLQKLYLSKNQISRFPMELVKE
KSHLEKLSLLDVSSNKIKMLPIDELQALPAWIKNGLYFHNNPLLCHCDLYTLLSHWYIRK
MNSAMDFKDDYTCILAGPQKNKVGVFNLSGDSMNCSTFKEADEEAFLEQRLILGCDTKRR
GMLKTWITPGNVVVTPGSNQTAKVLPDGNLQIDPVRNEDSGTYTCFAMSEATNETIYVVL
KVHNFTMHGGSDSLNTAYTTLVGCLASVVLVLMYLYLTPCRCFCCPNKGKAPGDDSIHSS
MLSVTPTHEDPALNRHVAFIDSKDLRGQNGKLNPSGEDDDDDLDAEAGSLMKGKRKKSVA
ESISSVFSDTPMVV
Download sequence
Identical sequences G3NYD0
69293.ENSGACP00000010350 ENSGACP00000010350 ENSGACP00000010350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]