SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011058 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011058
Domain Number 1 Region: 15-331
Classification Level Classification E-value
Superfamily DNase I-like 7.32e-66
Family Inositol polyphosphate 5-phosphatase (IPP5) 0.00000926
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011058   Gene: ENSGACG00000008367   Transcript: ENSGACT00000011081
Sequence length 440
Comment pep:novel group:BROADS1:groupXIII:8413473:8418657:1 gene:ENSGACG00000008367 transcript:ENSGACT00000011081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VSQLRCNIKKKQSVRFIRLHFITWNVGSATPPDDITSLLGLNVGDGNTDMYIIGLQEVNS
MINKRLKDVLFTDQWSEVCMERLSPFGYVLVTSQRMQGLLLLVFAKYFHLPFLRGVQTET
TRTGLGGYWGNKGGVSARMSAFGHTICFLNCHLPAHMENSGQRMEDFESILQQQQFEGQT
ATGVLDHDVVFWFGDLNFRIEDLEMQVVKTAIDTNKFPMLWEKDQLNMAKDSETVLEGFQ
EGPLKFPPTYKFDVGTDTYDTSSPSGKKRKPAWTDRILWRLRATAAAGAGKRGSTLGLTS
GTKVTQHYYRSHMEYTVSDHKPVSSIFTLQFPYKLDMPLVTIIVEDEWNSIDDAVAKFRL
APNYPRSSWDWIGLFKVGFKHHKDYVGYVWAKQEEADFTRQDHQVTFTEEELPKGSGDFI
LGYYSNNMSTIVGVTEPFQV
Download sequence
Identical sequences G3P0D5
69293.ENSGACP00000011058 ENSGACP00000011058 ENSGACP00000011058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]