SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011810 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011810
Domain Number 1 Region: 56-197
Classification Level Classification E-value
Superfamily PH domain-like 0.00000043
Family Phosphotyrosine-binding domain (PTB) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011810   Gene: ENSGACG00000008941   Transcript: ENSGACT00000011834
Sequence length 202
Comment pep:novel group:BROADS1:groupXV:6140463:6143570:1 gene:ENSGACG00000008941 transcript:ENSGACT00000011834 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRMKVKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSRNSSSE
TCGEFRVKYVGAIEKLQFDMSKTLQEPLDLINYIDAAQQNGKLPFVPGDEERILGVSKYG
IKMASLDQCDVLHRHPLFLIVRMLCYDDGLGAGKNLLALETTDAKQEECSIWVYQCSSSE
QAQSICKVLSASFDCALTSVKS
Download sequence
Identical sequences G3P2I7
ENSGACP00000011810 ENSGACP00000011817 69293.ENSGACP00000011817 ENSGACP00000011810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]