SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000012637 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000012637
Domain Number 1 Region: 75-338
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.17e-49
Family Ankyrin repeat 0.0002
Further Details:      
 
Domain Number 2 Region: 413-458
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000353
Family SOCS box-like 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000012637   Gene: ENSGACG00000009576   Transcript: ENSGACT00000012661
Sequence length 464
Comment pep:novel group:BROADS1:groupXI:7065895:7068997:1 gene:ENSGACG00000009576 transcript:ENSGACT00000012661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKDTFPFTPTSLRSLRLERELQDWEDARRALAHRRAMTRDPLPRAPRPPPRQQRLQQVR
APAPQARCRDTAVHNTFMCGDMKGVYAVLKDPAMVNALMETAQEEMAWAPEMGMWTLSSK
MKQTSALRLAACGGRAGIVEELLFRGAEVNTDPGGNTALHDACAGGHDACVQLLLSHGAD
PEVLAADGSAPLHLCTSAQSFQCAALLVDAGADVSVRMRESRLTPLHAAARRGLEEHVAL
FLAHGADVAATNQEGETPLNAACSAAERPSEAGRYLRVVQRLLSAGADPRTAGRKQHTPL
HNACANCSPRIVEVLLQHGAEARVANCAGYTPMDCLIQVVEDYPGQQPEAVARSLLNHGA
EPVAPKMLQLCVLSPATLEVMLNSYTSIPACEWMDSLPAEIREEHRPFFDLVRRRSAGPR
SLQHLCRCAVRLRLGGRCFPAVRELDVPRSTRDYLLLRNDGTLL
Download sequence
Identical sequences G3P4W4
ENSGACP00000012637 69293.ENSGACP00000012637 ENSGACP00000012637

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]