SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000013565 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000013565
Domain Number 1 Region: 34-75
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000039
Family EGF-type module 0.012
Further Details:      
 
Domain Number 2 Region: 84-128
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000234
Family EGF-type module 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000013565   Gene: ENSGACG00000010263   Transcript: ENSGACT00000013590
Sequence length 709
Comment pep:novel group:BROADS1:groupXI:7947648:7954421:-1 gene:ENSGACG00000010263 transcript:ENSGACT00000013590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRWNLMILVLYLSLMVVLSTHCPNGQVQLPGKGKNCIDVDECAEDIKRCGKNATCHNT
FGSFYCQCDVGFISTSQSLNFSAADNEVCKDINECLQDKDICGPNAKCHNAIPHYSCSCL
NGFYSTNGSKSFRGSKDITCQAKMQHATTHQEVINVCVTVASDSNLADLTSLAVRSNVKE
ARIQKRKVSTFLNLVENVLKLAAAFIEPPGTTRSSTHTGAETICAHKHIFSWNVLFPKLV
DFPFLEVRNSIIRHEMSVDKSVSTLVSELELLVKKGADLPKGAVTLSSKQAKLDLQLETA
AGDSSYYPGNDLIAVIVKGFTTVYLLGYANLEDFTKGFFGRMKPEANHRFELNSNVVTVS
VSNRNTSHLEVPVKLTLYHLKQTNEFDHTCVFWDASEEGGSWSTQGCQVVESKAEYTVCS
CNHLSSFAVLMALYDVEVETLAHTFELQLITWLGLSLSLICLFICILTFSLIQSLKSPRT
TIHLHLCINLFIAFIIFLAGISRTENRVGCAVVAGLLHFFFLAAFCWMCLEGIQLFRMVV
LVFNTNFRTLYMLAGGYGVPAVIVAISALVNAKGYGTERYCWLDLGFIWSFFGPVCVIIT
VNIFFFLITVWKLAEKFTSLNPDLDNLHKIKVFTITAVAQLTLLGTMWIFGCFQFNEGTI
VTSYLFTLCGSFQGVMLFVMHCLLSKQVEHAHYSFRVLKLMRYCWRCEV
Download sequence
Identical sequences G3P7J1
ENSGACP00000013565 ENSGACP00000013565 69293.ENSGACP00000013565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]