SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000014285 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000014285
Domain Number 1 Region: 226-334
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-27
Family SH2 domain 0.00000149
Further Details:      
 
Domain Number 2 Region: 338-379
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000000144
Family SOCS box-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000014285   Gene: ENSGACG00000010795   Transcript: ENSGACT00000014310
Sequence length 387
Comment pep:novel group:BROADS1:groupI:11579509:11580798:-1 gene:ENSGACG00000010795 transcript:ENSGACT00000014310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTLRQKIQDAMGQCFPIKTNSAVAPVPSPQALSSTACASSRRKIHLSELMLDDCPFPVGS
ELAQKWNLIKQHTAPITQPPLLESAVVCVSPAVATATVVEDVDDKLRERRRISIEQGVEP
PPNAEIHTFEVTAQINPLYKHGPKLAHGMNELAGADRAPHHQLLLQSCLDTLDEVVASAS
ASASAPALASVHTGDAMPNPVVNPEEHKTHDGYRIHTQIDYIHCLVPDLLQITNLPCYWG
VMDRYEAETLLEGKPEGTFLLRDSAQEDYLFSVSFRRYGRSLHARIEQWNHNFSFDVHDP
SVFHAPTVTGLLEHYKDPNSCMFFEPLLSNPIHRSQPFNLQHICRGVISSCTTYDGINVL
PIPNTLKKHLKEYHYKQRVRVRRMDTW
Download sequence
Identical sequences G3P9L1
ENSGACP00000014285 69293.ENSGACP00000014285 ENSGACP00000014285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]