SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000015345 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000015345
Domain Number 1 Region: 249-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000314
Family Laminin-type module 0.035
Further Details:      
 
Domain Number 2 Region: 922-1158
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000222
Family Tropomyosin 0.0017
Further Details:      
 
Domain Number 3 Region: 478-528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000014
Family Laminin-type module 0.024
Further Details:      
 
Domain Number 4 Region: 377-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000391
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 5 Region: 314-366
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.031
Further Details:      
 
Domain Number 6 Region: 429-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000474
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 7 Region: 526-573
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000271
Family Laminin-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000015345
Domain Number - Region: 90-144
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00969
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000015345   Gene: ENSGACG00000011602   Transcript: ENSGACT00000015375
Sequence length 1165
Comment pep:novel group:BROADS1:groupXVII:12652011:12662065:-1 gene:ENSGACG00000011602 transcript:ENSGACT00000015375 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FAGVFLLTAIAAASQAQTDCSRGACYPPSDDLLSGRTQLLHASSTCGLMGSEIYCTPYQQ
RKMECCPCDSRNPNSRLAHTVRDVLPTSGPNRWWQSVKDVNPVTLQLDLDNLFQLDNLVL
KFKGPRPSSFVIERTLDNGRSWQPALYLATDCEGTFPGVSTTPPLRLDDTYCYTLPPTGA
NPYQDYEVQFSPLRQYANVPTTKSQMIEDVSGLTGLRVRFTELGDVPRPPGRAFSRFYAL
REMRAMGSCMCHGHANRCLPDTGSNQLPDGVQVHPQCDCQHNTAGVNCERCAELFQDLPW
RPAEEGNPHTCKRCECNNHAQRCRFDPARYEASGRRSGGVCEGCAHHTAGPKCDQCAAGF
QPNPRSQMDRPDACIRCICNADGTVNGGRCDESTGSCLCKENVEGPRCDRCVRGYYDLSP
SNPLGCSECSCSPDGSLSDACDPITGQCTCRSHFRGLKCEVCSQGYWKPPFTGCCQACGC
DPTRSYGDTCDQVTGQCQCRPGFGGLKCTECAENTYGNPLTGCKPCRCDAEGTLPEVCDK
QTGACLCRPGISGTRCDSCSRGHCDSFPGCEKCPSCFFTLDAQREKLSSALEKLSLRVPS
RPGDGDLGNFTPRIRVLEASLSLIQKSISLPPGVAVQVDDAVSELNKLRDKVDKINDDLS
PLERAPGLDSELDRLQALLDSLTLVYKAKVDGKDNSVSPNNTGAFSAIKNAYNESTDAAK
KVISTKKPLKESADIREAAMDLQNTVQPGNTRDLDKLNQTMASKPNLTPVAKQVCGSLRS
EPCTPLQCAGGDLCPPDGTPPCEKGEVCVGALPLSKRADADAKDVKGRLDKLTGKITDAA
EKLQQTQETTNQVRKSAEKLSNKMKRARDALEDDLKDTQDLVNKLKDFLSADPSSNLTHI
QEVSDWILNAKLPLNLADLMKKLEELKNLADSLPDSSSVLKEAEPQLDAARKLLQEAQDA
RDTALGVKADVDGLLDAFGSGEGSLSDLEDRLQATMDNIDNLNSSLTEAKEQLSPAEKAL
DDASDLIKPMKPQLDELKDLLKTVVPLVQNVTDNAESAEDEAAAANEDLLTLEDQLDRLK
DQAPTTGSGGPELGDRVAKLQKDAGALANSTNEMMTALEGKADSLRGLQDEIRQKSTKLE
GLDAKLKELLDQLRQKGQDLSICQG
Download sequence
Identical sequences G3PCM1
ENSGACP00000015345 69293.ENSGACP00000015345 ENSGACP00000015345

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]