SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016261 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016261
Domain Number 1 Region: 233-431
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.27e-45
Family Reprolysin-like 0.00041
Further Details:      
 
Domain Number 2 Region: 448-524
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 2.12e-18
Family Blood coagulation inhibitor (disintegrin) 0.00046
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000016261
Domain Number - Region: 680-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0226
Family Integrin beta EGF-like domains 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016261   Gene: ENSGACG00000012292   Transcript: ENSGACT00000016293
Sequence length 933
Comment pep:novel group:BROADS1:groupXX:13425309:13464336:-1 gene:ENSGACG00000012292 transcript:ENSGACT00000016293 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILCVCGLMHVGHQSSSNATNGDASSSMKALRDAGRFAGKEDTVPLRLLYSPHSRNQMPED
ELSTRVKAGSGSTPFQVNHVAQASFQVDAFGRKFLLDVELNHDLLSSGYVERHLSEKGRT
VVTSGGEHCYYQGKVRDVPHSFVAVSTCHGLYGMFFDGNHTYMIEPGGPGDGNGDVRIHM
IYKSAGQEGFNDLINGDFPEPPFPSPPFPGSRVIHRRKKRQAPYLSRSAEDENKYIELMV
INDHLMYKKHRLSVGHTNNYAKSVVNMADMIFKEQLNTRIVLVAMETWSADNKFNIDDDP
MVTLKEFMKYRKDFIKEKCDSVHLFSGNRFHSSWGGASYMGGVCSLTKGGGVNEYGKTDE
MAITLAQSLGQNIGIFSDKKRILNGECKCDDRWSGCIMDDVGFYLPKRFSECNVEEYHNF
LNSGGGACLFNKPLKLLDPPVCGNGFVEPGEECDCGSPLECAREGEACCDKCTLTQGSKC
SNGLCCNKCQMEFMGVVCRDSVNDCDIPENCTGNSSQCPPNVHKMDGYTCEKDQGRCFNG
RCKTKDRQCKYIWGEKATAADKFCYEKLNIEGTEKGNCGKDKDTWIQCNKQDIHCGYLLC
SNISPAPRLGELQGGLTSFSVARHSASLDCSGAHVLIDGDTDLGYVEDGTACGTDSICFD
QKCLPIQQFNFSTCPGTTDKIVCSGHGVCSSELKCVCYLGWAGEDCNSTSPLSYLVVGPT
ASVSVSGIRSTNIIIGAIAGSILLLALILAATAWGYKSYKQRWQMPPGDYVTKPGDADSF
YSDMPPGVSTNSGCSSKKRSACLSHLQICTLSFTPSFPSISQNISLFGFRSNGLSHSWSE
RIPDAKHISDICENGRPRSNSWQGNLSGNRKKLKGKKFRARSNSTETLSPAKSPTSSTGS
IASSRRYPYPMPPLPDDQRKASRQSAKLWETSI
Download sequence
Identical sequences G3PF87
ENSGACP00000016261 ENSGACP00000016261 69293.ENSGACP00000016261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]