SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000016432 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000016432
Domain Number 1 Region: 216-378
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 1.47e-45
Family Pentapeptide repeats 0.00018
Further Details:      
 
Domain Number 2 Region: 89-191
Classification Level Classification E-value
Superfamily POZ domain 2.75e-27
Family Tetramerization domain of potassium channels 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000016432   Gene: ENSGACG00000012418   Transcript: ENSGACT00000016464
Sequence length 389
Comment pep:novel group:BROADS1:groupXIII:14474158:14477065:1 gene:ENSGACG00000012418 transcript:ENSGACT00000016464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRVTLFVNGTSKNGKVVAVYGTLPDLLSVASSKLGIRAASVYNGKGGLIDDIALIRDDD
VLYVSEGDQFVDPQNEPAVASDQHGSQTDWLTLNIGGRPFTTTRSTLVSKEPESMLAHMF
RERDVWGNTQDEHGAYLIDRSPEYFEPILNYLRHGQLIINEGINIRGVLEEARFFGIEQL
AEQLEVAIKNTQPPEDHSPISRKEFVRFLLATPTKSELRCQGLNFSGADLSRLDLRYINF
KMANLSRCNLTHANLCCSNLERADLSGASLDGANLQGVKMLCSNAEGASLKGCNFEDPSG
LKANLEGANLKGVDMEGSQMTGINLRVATLKNAKLKNCNLRGATLAGTDLENCDLSGCDL
QEANLRGSNVKGAIFEEMLTPLHMSQSVR
Download sequence
Identical sequences G3PFQ8
ENSGACP00000016432 ENSGACP00000016432 69293.ENSGACP00000016432

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]