SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000017910 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000017910
Domain Number 1 Region: 8-114
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-28
Family Spermadhesin, CUB domain 0.00046
Further Details:      
 
Domain Number 2 Region: 148-313
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000403
Family Pentraxin (pentaxin) 0.0091
Further Details:      
 
Domain Number 3 Region: 839-1135
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.00000000146
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000017910   Gene: ENSGACG00000013550   Transcript: ENSGACT00000017945
Sequence length 1247
Comment pep:novel group:BROADS1:groupXVIII:15849000:15875865:-1 gene:ENSGACG00000013550 transcript:ENSGACT00000017945 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ALGCSSSSCNVELTEAQGEFTSPCYPQKYPNLQACKWTMQAPAGFIVQLSFLDFDLEEAP
GCIYDRVLVHAGNADVRFCGPTASGLTLNSTGDVMELSFTSDFSVQKRGFSVSFPTRINR
TQGAWRSFPELHWGHPVIDGSIGSPVPTVSQPTLCFEVHASNPHTGEWILSYSDSSGSEA
LSLGSDQSSMKVLVDGVVCPVDSILSPADFTSSMRRYCLLWTASDGRVGVHFNGNYWATT
CSASTGRSLPPAGRFRLGESAHSFLASGQQSFDGNVYNLRLWDYAMTVQQLNALSCDAVG
NVIDWDNSHWSIPSGSAQTDTSLSCSESVLPPIPASPSTAPTTSMPLTPTSSSSSSLPSA
STVSLPCVTVYVPVAQQTAVSSAPTNPPTTNPAAPGSTGTLSSETSGLPPQTETPTQFQD
PPRLHLHTFDLAETGLCGLSSGNITKNRRRREPKEQSSVMTHAREEQITQKGSFYRVSLV
VDGGVALTRAEVERAVALWLNETFQNWTHVVYVDSISSWCRALLVYYHSTNESLGGPALS
ARLSAREGLLGGGGLQIVPASIDVHVVENAAEVASQLAVITNNELSDEEVSKVVTKVKQL
VNVAEINSSLASTVVTIISNVMSSSETVLAASSDKALKTVDELVQKIQFEGPSISISSKH
LAVGISTLNASVFNGTSFSAFVAPNSTYPQIDFQSGRSNPLAQVSLPASLLSGTSLTEEE
RSSLSRINFMFFSSTNLFQKEQDGRSLNSYVVASSVGNLSIRDLKDPVEIQIAHLSEHTH
LNPVCMFWDFSMSGGAGGWNADGCRTSTESSSNRTVCLCDHLTHFGILMDISRASPHIDQ
ENNRILTFISYVGCGISAIFSAATLLTYVAFEKLRRDYPSKILMNLSTSLLCLNMVFLLD
GWLASLDTHWLCMSVAIFLHYFLLTTFTWMGLESIHMYIALVKVFNTYIRRYILKFCLVG
WAGLPAVLVGLVVVVDQTSYGLQQYSGGHSGDGSSQFCWIQNPVVFYTSCVGYFCLVFLL
NVAMFIVVMLQICRNGKRSNRTLREEVLRNLRSVVSLSFLLGMTWGFALFAWGPVSLAFM
YLFAIFNSLQGLFIFVFHCALKENVQKQWRRFLCCGRFRPSDYSDGSKTPTNNTKKVSSD
QLGKSLSSGSFGSTTASWTSKAKATLNPFTKRHSNTDKCYSNQTGPQCVSSCSSSSEAEP
HSSSSSSSSILPVSQMIDKVRGYCSTRSDNFYKNIIMSDSFAHSTKF
Download sequence
Identical sequences G3PJY0
ENSGACP00000017910 ENSGACP00000017910 69293.ENSGACP00000017910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]