SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018050 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018050
Domain Number 1 Region: 34-62,104-384
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.21e-60
Family WD40-repeat 0.00028
Further Details:      
 
Domain Number 2 Region: 380-424
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000497
Family SOCS box-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018050   Gene: ENSGACG00000013651   Transcript: ENSGACT00000018085
Sequence length 427
Comment pep:novel group:BROADS1:groupI:19581479:19591703:1 gene:ENSGACG00000013651 transcript:ENSGACT00000018085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFPDSVNENDIGQAKFIGELLVPVAPFDQKSGREAWTVAFAPNGSYFAWSQGHRIVRL
IPWAKCLKNFSIGHDGEATNALSPRRLSRQNSGEGQLIPEADEPREHTIDCGDVVWGLAF
GSSVPEKQSRCVNIEWHRFKFGQDQLLLATGLNNGRIKIWDVYTGKLLLNLMDHTDIVRD
LTFAPDGSLMLVSASRDKTLRVWDLKDDGNMVKVLRGHQNWVYCSAFSPDSSILCSVGAG
KAVFLWNMDKLTLMRKLEGHHNDVVSCEFSPDGALLATASYDTRVIVWDPHKATVLLELG
HLFPPPSPIFAGGANDRWVRSVSFSPDGRHIASITDDRLVRFWSIEERAPQAVGSLPSGL
CCAFSADGSVLAAGTRGGSVHFWECPRSVASLQHICRMSLRRVMTTQQVETLAIPMPLRD
FLTYKVI
Download sequence
Identical sequences G3PKC0
ENSGACP00000018050 ENSGACP00000018050 69293.ENSGACP00000018050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]