SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018281 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018281
Domain Number 1 Region: 173-245
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.53e-17
Family PHD domain 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000018281
Domain Number - Region: 286-325
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00465
Family PHD domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018281   Gene: ENSGACG00000013838   Transcript: ENSGACT00000018316
Sequence length 749
Comment pep:novel group:BROADS1:groupVIII:18010071:18014089:1 gene:ENSGACG00000013838 transcript:ENSGACT00000018316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKRLRSSSSSDTSDNESPSTSFCSSHKYGGGKPEAPAANQKKPAEVSPPSPHLPAVVADL
RCTGEDECLGKGPRRVPAAYPGGALWPRYTSKAPPAHQRSCNPDYLNQPTVSFSFNAQLH
NAITDVNAFLLTCKIKCSASPGEEPVHELTMERAMEALESQCHDNMNHAIETVEGLGIEY
DEDVICDVCRSPDSEEGNDMVFCDKCNICVHQACYGIVKVPVGNWLCRTCVLGIDPQCLL
CPQKGGAMKATRAGTKWAHVSCALWIPEVSIACPERMEPITKVSHIPPSRWSLICSLCKW
KTGACIQCSVKNCTTPFHVTCAFEHSLEMKTILDEGDEVKFKSYCLKHSQPKAGEAGPGP
ARSKPAGDAQKAGPRAQRLRELEEEFYTLVQQEDLSRALGLPARLLDFICQYWKLKRRAN
FNRALLPPKEDEENLVLQPQEDSIHTRMRMFMHLRQDLERVRNLCYMVSRREKLKVLQSK
AHEQMFNLHVKLLNQELSAGLPSSSPAESLLFRPPPRITLKLKMPKPSGPGNGNAGSKSG
NGPLCPDHSGNVGEGEGLGQGKPQLHGRGRREERPNGRLTSSSSKPLALHAALHGGHSSN
GRPDPDRKSNGLSEKPAALKDSSCQTPGDPDASAPALEKSGLRKSAMEHFGRSFKEATIN
LVRTTEDLRASDKLSRKGGAKERLWAKPEHRAKGGRSYQDSDGYCPDLELSDSEPEAKGR
RRQVGPPDAGGKGVGRGKQSLASRHAVQR
Download sequence
Identical sequences G3PL01
ENSGACP00000018281 ENSGACP00000018281 69293.ENSGACP00000018281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]