SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000018915 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000018915
Domain Number 1 Region: 166-360
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.66e-55
Family Prokaryotic proteases 0.000000777
Further Details:      
 
Domain Number 2 Region: 377-473
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-19
Family HtrA-like serine proteases 0.0015
Further Details:      
 
Domain Number 3 Region: 29-119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000267
Family Growth factor receptor domain 0.0015
Further Details:      
 
Domain Number 4 Region: 106-151
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000185
Family Ovomucoid domain III-like 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000018915   Gene: ENSGACG00000014314   Transcript: ENSGACT00000018953
Sequence length 476
Comment pep:novel scaffold:BROADS1:scaffold_112:27482:36338:-1 gene:ENSGACG00000014314 transcript:ENSGACT00000018953 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRLVLCVMALLVRPPPAAGARRAKRFAIGCPEKCDVSVCAPIPADCPAGDALDHCDCC
PVCASGEGEQCGGTARRECAEGMECAVTGGVEASATVRRRGAAGVCSCTSSDPACGSDGV
SYRNICELKRVSNRAMKLRQPPVIFIQRGTCGQGQQNPDSLRLKYNFIADVVQKIAPAVV
HIELYRKMMFSKREVAVASGSGFVVSEDGLIVTNAHVVANKHRVKVELKSGATFDARIKD
VDEKADIAVIEIDAPMKLPVLLLGRSADLRPGEFVVAIGSPFSLQNTVTTGIVSTTQRGG
KELGLRNSDIDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVAAGISFAIPSDKIRQFL
VESHARQAKGKTYQKNKYVGVRMMSLTPALTKELKEKQSDFPDITSGAYVIEVIGRTPAE
AAGLQEKDVIISINGEPIASASDVSAAIRRDDTLRTVVRRGNEDVLLSIVPEEIEP
Download sequence
Identical sequences G3PMT2
ENSGACP00000018915 ENSGACP00000018915 69293.ENSGACP00000018915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]