SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000019513 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000019513
Domain Number 1 Region: 67-106
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000144
Family SOCS box-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000019513   Gene: ENSGACG00000014777   Transcript: ENSGACT00000019551
Sequence length 146
Comment pep:novel group:BROADS1:groupXI:15885037:15887971:1 gene:ENSGACG00000014777 transcript:ENSGACT00000019551 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHYRGTFSLWCHPKLEDRCLSVVEFIERAIMYSKNGKFLYFLRSRVPGLPPTPVQLLYP
VSRFSSVKTLQHLCRFCIRQLVRIDHIQELPMPMPLIAYLGKFYYYDSEEEVSPSLKERG
LETQGCLVQQVQPVVQPVHHGLHSNT
Download sequence
Identical sequences G3PPH9
ENSGACP00000019513 69293.ENSGACP00000019513 ENSGACP00000019513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]