SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021779 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021779
Domain Number 1 Region: 38-256
Classification Level Classification E-value
Superfamily L domain-like 2.93e-32
Family Ngr ectodomain-like 0.013
Further Details:      
 
Domain Number 2 Region: 250-344
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000137
Family I set domains 0.016
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000021779
Domain Number - Region: 440-515
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000199
Family Fibronectin type III 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021779   Gene: ENSGACG00000016496   Transcript: ENSGACT00000021820
Sequence length 640
Comment pep:novel group:BROADS1:groupIV:1992232:1996986:-1 gene:ENSGACG00000016496 transcript:ENSGACT00000021820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPLLCVQVFVCCLSMARPFCPSQCTCVFHGRTDGTGTRSVLCNDPDMSDVPVNVPVDTV
KLRIEKTMVRRIPTEAFYYLVDLRYLWITYNSISSVDTASFYNLKVLHELRLDGNMISVF
PWESLKEMPRLKTLDLHNNRITNVPNEAIPFLLNITYLDLSSNKLTTLPSDLMDIWPPFN
GAPMSHNVSQKVVLGLQDNPWFCDCKISKLIELSKMSGTPVVLMDQFMVCSAPENLSGVL
FQRAELDNCVKPSVMTSATKITSPLGSNVLLRCDAAGFPTPTLYWDKSDGSLVNNTATVQ
ESPGDGVRWSIMSLHGILHKDAGNYSCKAKNVAGNAEAAISISVAGALSTTILPLRPTVE
PGSTSQGPTFTPSTDTSNSLVTTSTVLPKTSTAVVTKKPKTTTSTSLQKGPLKQAKAQQG
AGGRKLAADEKSKKGDASKSVKDLKIVEETVDTAVLLWRADGLPNDAALTVVYSPYDEDD
SKRTMETNAGSGKVLLEGLSSGIRYSVCLVAKGGAAGKDPCVDFYTLDNVQDGGQSRLFN
IVSGIACALVLSLIALLLYKIIHLYCKGSGTALDEEELEKDSYVKFETISMKQRTLNSHP
TEFWVRRATTESERMLLCSRSSIDSQMTYKSDSSRCEYLC
Download sequence
Identical sequences G3PVZ0
ENSGACP00000021779 69293.ENSGACP00000021779 ENSGACP00000021779

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]