SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000021900 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000021900
Domain Number 1 Region: 44-155
Classification Level Classification E-value
Superfamily FKBP-like 3.07e-36
Family FKBP immunophilin/proline isomerase 0.00000219
Further Details:      
 
Domain Number 2 Region: 2-39
Classification Level Classification E-value
Superfamily WW domain 0.00000000000638
Family WW domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000021900   Gene: ENSGACG00000016585   Transcript: ENSGACT00000021941
Sequence length 156
Comment pep:novel group:BROADS1:groupIX:4578551:4581783:1 gene:ENSGACG00000016585 transcript:ENSGACT00000021941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEEKLPGGWEKRMSRSSGKVYYFNHITNASQWERPVGDGRGEPEKVRCSHLLVKHSQS
RRPSSWREQNITRTKDEALELIQKYIEDIKSGEEKFESLASQFSDCSSAKNGGDLGLFGK
GQMQKPFEEASFALKVGDMSGPVFTDSGVHIILRTG
Download sequence
Identical sequences G3PWB1
ENSGACP00000021900 69293.ENSGACP00000021900 ENSGACP00000021900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]