SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022288 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022288
Domain Number 1 Region: 349-687
Classification Level Classification E-value
Superfamily L domain-like 1.87e-40
Family Ngr ectodomain-like 0.032
Further Details:      
 
Domain Number 2 Region: 42-337
Classification Level Classification E-value
Superfamily L domain-like 3.85e-37
Family Ngr ectodomain-like 0.029
Further Details:      
 
Domain Number 3 Region: 759-908
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 5.62e-31
Family Toll/Interleukin receptor TIR domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022288   Gene: ENSGACG00000016874   Transcript: ENSGACT00000022330
Sequence length 911
Comment pep:novel group:BROADS1:groupIX:5558990:5562539:1 gene:ENSGACG00000016874 transcript:ENSGACT00000022330 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHATRSLLSLVVIITCDLMTEKHNCLASQKKTSCSVQDGRADCSHLSLTAVPRDLPKGIT
SLDVSHNRLKTIPPASLALYPGLRHLNVSYNSITRLERGLCQTLPLLQTLNMEHNVVHVL
EMEDVSHCTNLTQLVMASNKLQLHGAPFSALQSLRVLDVSKNKLQSASLGSQPQLPGLVS
LNLAFSYFTTLKKDDFSYLSHSSFLRVLNISSVPLKTQLEPGCFKPISGLRTLIMDGSQM
GTNVISKLCSELAVTAIDALSLQKTKLITLPKAAFAGLQKTNITFLDLSRNTMGKIEGGA
FSSLSRLQTLILSDNNITRLSNDTFQGLNSLKTLQLTKALVKSHRIPIIEDFSFQPLGAL
ESLILQRTVVHEITEHTFSGLTSLRELDLSFSNYTSLKIITNKTFVSLAGSPLTKLNLTW
TAIAKIDPGSFSVLRNLTTLVLDFNFIKQVLTGREFEGLDQVEEIHMSVNHQTVGLSSTS
FVNVPNLRILTLGRSLTAEAVNVDPSPFSPLAKLTVLDLSNNNIANIRVNMLEGLVNLKV
LMLQHNNLARVWKSGNLGGPVLFLKSAERLTTLHMDSNGLDEIPAEALSGLGNLREISLA
NNLLNNLQNSIFDHLSSLRVLNLQKNLLTAVRPQVFQAPLRNLSLLLMDRNPFDCTCESM
VWFVKWLNSTNGTRVPGLRDQYLCNTPLAYFNRSVMVFDTLSCKDMTPFQALYILSSTVV
ITLMVSALLVRFQGWRIQFYWNILINRALGFSDAEVEEGREFEYDAYVIHAEKDASWVER
RIAPLENDMCRFCLEDRDSVPGMSKLESIVDNMRKSRKILFVVTETLLRDPWCRRFKAHH
ALHQVIEASRDSVVLVFLQDVHDFKLSRSLFLRRGMLRSCCVLDWPVHKERVPAFHQKLL
IALGMTNRLQE
Download sequence
Identical sequences G3PXE9
69293.ENSGACP00000022288 ENSGACP00000022288 ENSGACP00000022288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]