SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022548 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022548
Domain Number 1 Region: 41-240
Classification Level Classification E-value
Superfamily L domain-like 1.44e-39
Family Ngr ectodomain-like 0.003
Further Details:      
 
Domain Number 2 Region: 246-349
Classification Level Classification E-value
Superfamily Immunoglobulin 6.69e-17
Family I set domains 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022548   Gene: ENSGACG00000017072   Transcript: ENSGACT00000022590
Sequence length 683
Comment pep:novel group:BROADS1:groupII:19659816:19661930:-1 gene:ENSGACG00000017072 transcript:ENSGACT00000022590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASTGIVYLALWLTSVFTAGLGCPELCTCSDKYERHFAECSYKDLVQVPGDLPPNVTTVS
LSANKITLLPIGCFDNVTQVTSLWMAHNEIVSIEEGALTPLVHLRNFDISHNMIVDFPWE
DLQNLTGLQLLKMNHNEMVHLPKDAFYNLKDLRSLRLNNNKFITITEGTFVGLVSLSHLQ
IYKNPFACDCSLGWLRDWISSTAITVPEQNLIICASPQKLRGKAIGILPKSKCTGTNVTI
RAEPNIHNMTFYEGSALVLTCEFRGNPKPLVIWNIHSESRKEELALSFAEDDSAESNEDS
LLSHGPVKVFNNGTLVISHLRREDSGSYNCSATNENGRAQDSVSVVVVALTKPTPTEQKT
TTPTYTKSHLPIMKTTHKTSVLDFVHLPDLKRKDMMKIEPTFPPDENIRSEETTNPSGTS
TCGLTANTRNISSQVFSGSLEDTKQYTFDFGVIALAVSETEATVRLNPLLIPRYDSANGA
AAASDESSDIDSEEHDSFSDLSKKANSDGLYLCITGDRKHSAVQWSRIKEGVGTYLFSGL
RPSTNYSLCLTYRGEDCEVQVLFTTRRRVPNLLIIISVSICLLTVSTVPLLGATCFHLVY
KYRSKTYKLILKAKGQYHMERNLTANFNVRAPHTESRRKIDSGRIMTESFSLSHCRGNSD
NCEVGSEYSDRLPLGAEAVNITS
Download sequence
Identical sequences G3PY59
ENSGACP00000022548 69293.ENSGACP00000022548 ENSGACP00000022548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]