SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000022859 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000022859
Domain Number 1 Region: 311-435
Classification Level Classification E-value
Superfamily EF-hand 8.71e-45
Family EF-hand modules in multidomain proteins 0.0000101
Further Details:      
 
Domain Number 2 Region: 438-532
Classification Level Classification E-value
Superfamily EF-hand 1.77e-37
Family EF-hand modules in multidomain proteins 0.0000289
Further Details:      
 
Domain Number 3 Region: 514-601
Classification Level Classification E-value
Superfamily RING/U-box 3.88e-18
Family ZZ domain 0.013
Further Details:      
 
Domain Number 4 Region: 149-270
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000619
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 5 Region: 23-156
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000694
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 6 Region: 273-310
Classification Level Classification E-value
Superfamily WW domain 0.0000000000104
Family WW domain 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000022859   Gene: ENSGACG00000017306   Transcript: ENSGACT00000022902
Sequence length 880
Comment pep:novel group:BROADS1:groupIV:6251502:6299440:-1 gene:ENSGACG00000017306 transcript:ENSGACT00000022902 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPHQAGEMNLCWNEIKRKSHNIRVRLEAFSDSSGKLQLSLQEIIEWLTAKDEELSEQLPI
GGDAGAVQHQREFHQAFMEDVKSRGPFIYSVLESAQAFLAQHPFQEPEETLTDGKEVSPR
RRILNVSRSVWKQANVASDLWEKLTARCVDRHRHMERTLERLLQVQAAMEELAVALEQAE
GVRDAWEPVGDLFIDSLQDHIDATKLFKEELTQVKEGMKHINDLAHQLAISDVHLSMENA
RALEHLNGRWKVLQASIEERLKQLQDAHRDFGPGSQHFLSSSVQVPWERAISPNKVPYYI
NHQAQTTCWDHPKMTELYQALVADLNNIKFSAYRTAMKLRRVQKALRLDLVALSSLVGVF
REQELQQGEHVMDVVEMIHGLTALYEKLEEERSVLINIPLCVDMCLNWLLNVYDSGRNGK
MRVVSFKMGLVSLCNADVQEKYKYLFRQVSGPGGSTDQRNLSLLLHEAIQIPRQLGEVAA
FGGSNVEPSVRSCFRVAPGKPAIEVSHFLEWMSLEPQSMVWLPVLHRVAAAESTKHQAKC
YVCKQCPIKGFRYRSLKQFNVDICQTCFLTGRTTKGKKLHYPIMEYYTPTTSGEKMRDFA
KTLKNKFRSKQYFTKHPQRGYLPVQSVLEAESSETPCSSPKLPHADTHSRIEHYASRLAE
MESQNCSFFTDSLSPDESLDEDQYLLRHSSPALDHDSPCGQHMLLANLEHQDKEQLQCTL
AHLENENRVLQSEYRRLKWKHEEAAAVPMLTEAGEGGPGSPAEGGQQDEELLAEARVLRQ
HKTRLETRMGILEDHNKQLESQLCRLRELLLQKQPKDDSEANGSEPSTLSSPVSGGGRHG
EPASRETTDTEAAGDDIEREQDTVLQLQEVIEQLRNVFPS
Download sequence
Identical sequences G3PZ19
69293.ENSGACP00000022859 ENSGACP00000022859 ENSGACP00000022859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]