SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023422 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023422
Domain Number 1 Region: 16-63
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000536
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023422   Gene: ENSGACG00000017725   Transcript: ENSGACT00000023468
Sequence length 107
Comment pep:novel group:BROADS1:groupXIV:9068437:9069945:1 gene:ENSGACG00000017725 transcript:ENSGACT00000023468 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPLPPPQHGGIDHNLPTCGDTQCSSHGTCVPSMDGGLVCDCNLGYQGETCDDTVNGSL
SLPLTLSVLAVIIGILIVAVILAKLRRKQKKRNRKHLEEKHGYDIVA
Download sequence
Identical sequences G3Q0M7
ENSGACP00000023422 69293.ENSGACP00000023422 ENSGACP00000023422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]