SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000023820 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000023820
Domain Number 1 Region: 153-272
Classification Level Classification E-value
Superfamily EF-hand 7.11e-31
Family Osteonectin 0.012
Further Details:      
 
Domain Number 2 Region: 241-335
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.92e-25
Family Thyroglobulin type-1 domain 0.00068
Further Details:      
 
Domain Number 3 Region: 91-137
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000123
Family Ovomucoid domain III-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000023820   Gene: ENSGACG00000018028   Transcript: ENSGACT00000023867
Sequence length 345
Comment pep:novel group:BROADS1:groupIX:9645774:9651002:1 gene:ENSGACG00000018028 transcript:ENSGACT00000023867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPSHQHYLGSIKAYSVFSDHTLLQEPGTWTPSKPFDQGLDPAKDPCLKIKCSRHKVCVSE
DYKTATCVSQRRVSFRTGCPALSVYQSPGSKCKPCPVVHPSPVCGTDGHSYSTKCKLDYQ
ACITGKKIAVKCSGMCPCPSQPEQSSAENCRSPVCSESDLKEVVNRLRDWFRVLYENGNH
KRVKIQKPEKNKFEVGTSPICKDPVGWMFPRLDTNFDVQLDQSEIKSLYLDRNEPCSDAF
FKSCDTHMDKVITSSEWCTCFQRYTDSPCKEELSSINKKQAGKKVIGQYLPSCDEEGYYR
SHQCHSSSGQCWCVDRYGNEDASSRTHGPANCGVILESSGDLGSG
Download sequence
Identical sequences G3Q1S2
ENSGACP00000023820 69293.ENSGACP00000023820 ENSGACP00000023820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]