SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000025759 from Gasterosteus aculeatus 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000025759
Domain Number 1 Region: 172-348
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 2.57e-16
Family YhfI-like 0.064
Further Details:      
 
Domain Number 2 Region: 60-163
Classification Level Classification E-value
Superfamily ISP domain 0.0000000000498
Family Rieske iron-sulfur protein (ISP) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000025759   Gene: ENSGACG00000019485   Transcript: ENSGACT00000025809
Sequence length 641
Comment pep:novel group:BROADS1:groupIV:25436324:25450435:-1 gene:ENSGACG00000019485 transcript:ENSGACT00000025809 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKYVVQQGLLWDDLYIGFQNRIRRDPDVYHHNLWDQGASRVGAMTSQRAKVVLSLGAETV
CSLKEGVNFKKNPQDGKCYIIFKSDNGFRACKNQCKHQGGLFIKDIEDLGGMTVKCTKHN
WKLNVSTMKYVNPPDSFLQDELEVELSEDGSLQLIELSPIDPWLADPREAVQLQDGEVKV
TYLTHACMELKLGQRRFMFDPWLKGPAFARGWWLLHEPPADSLDRLCAADLIYISHMHSD
HLSYPTLKVLSERKPDIPIYVGDTSRPVFWYMEQSQVKLTNIHVVPFGVWNNIDADLRFM
ILMDGVHPEMDTCIIVEYKGHTILNTVDCTRPNGGRLPQNVDLMMSDFAGGASGFPMTFC
GGKYSDSWKAEFIKNERKKLLNYKALLVKSLQPAIYCPFAGFFVEAHPSDRYIRETNVKN
SPEDLNALINKFAPDIKTWTPKPGAVLDLGLALRDPTNRTKRSGAITNPSDSTKIYKDSW
DLDLYVDELNRAINCEIFKHQSWTQFYYTWAGFQNYNLVVRMIETDDSFEPHADGSDYLV
DFLDLTFPTKRPEREHAYIEIKNRIGVMRYVVQQGLLWDDLYIGFQNRIRRDPDVYHHKF
WNHFQTQLPVRRPDWDQFLQEISLQEPDTAARGQGANCVTS
Download sequence
Identical sequences G3Q799
ENSGACP00000025759 ENSGACP00000025759 69293.ENSGACP00000025759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]